DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Urm1 and Urm1

DIOPT Version :8

Sequence 1:NP_996018.2 Gene:Urm1 / 2768949 FlyBaseID:FBgn0053276 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_001131034.2 Gene:Urm1 / 311840 RGDID:1306599 Length:101 Species:Rattus norvegicus

Alignment Length:102 Identity:64/102 - (62%)
Similarity:80/102 - (78%) Gaps:2/102 - (1%)


  Fly     1 MGTPELKIILEFSAGAELLFGNIKRRELNLDGKQK-WTIANLLKWMHANILTERPELFLQGDTVR 64
            |..| |.:.:||..||||||..:|:.::.|.|::: |.|.|||.|:..|:|.||||||:|||:||
  Rat     1 MAAP-LCVEVEFGGGAELLFDGVKKHQVTLPGQEEPWDIRNLLVWIKTNLLKERPELFIQGDSVR 64

  Fly    65 PGILVLINDTDWELLGELDYELQPNDNVLFISTLHGG 101
            |||||||||.||||||||||:||..|::|||||||||
  Rat    65 PGILVLINDADWELLGELDYQLQDQDSILFISTLHGG 101

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Urm1NP_996018.2 Urm1 7..101 CDD:286251 59/94 (63%)
Urm1NP_001131034.2 Urm1 6..101 CDD:286251 60/95 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C162085541
eggNOG 1 0.900 E1_COG5131
Hieranoid 1 1.000
Homologene 1 1.000 H41688
Inparanoid 1 1.050 133 1.000 Inparanoid score I4444
OMA 1 1.010
OrthoDB 1 1.010 D1541629at2759
OrthoFinder 1 1.000 FOG0003881
OrthoInspector 1 1.000 T1086783
orthoMCL 1 0.900 OOG5_128383
Panther 1 1.100 LDO PTHR14986
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.