DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Urm1 and urm1

Sequence 1:NP_996018.2 Gene:Urm1 FlyBaseID:FBgn0053276 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_587744.2 Gene:urm1 PomBaseID:SPCC548.04 Length:97 Species:Schizosaccharomyces pombe

Alignment Length:99 Identity:43/100 (43%)
Similarity:62/100 (62%) Gaps:5/100 (5%)


  Fly     6 LKIILEFSAGAELLFGNIKRRELNLDGKQKWTIANLLKWMHANILTERP---ELFLQGDTVRPGI 67
            :.|.:|...|.:|||...|...|:|.......:.:|:.:| |.|: |:|   :||:...||||||
pombe     1 MAIKVELLGGLDLLFNKQKALSLSLSNLGSTKLGSLIDYM-AQII-EKPSQKDLFILNGTVRPGI 63

  Fly    68 LVLINDTDWELLGELDYELQPNDNVLFISTLHGG 101
            :||:||.|||||.:.:|.|:..|.|:|:||||||
pombe    64 IVLVNDQDWELLEKEEYNLEEGDEVVFVSTLHGG 97

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Urm1NP_996018.2 Urm1 7..101 CDD:286251 42/97 (43%)
urm1NP_587744.2 Urm1 3..97 CDD:176360 42/96 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I1849
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003881
OrthoInspector 1 1.000 T1124768
orthoMCL 1 0.900 OOG5_128383
Panther 1 1.100 LDO PTHR14986
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1611
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.