DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and rhbdf1a

DIOPT Version :8

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:XP_005164392.1 Gene:rhbdf1a / 798402 ZFINID:ZDB-GENE-040704-75 Length:893 Species:Danio rerio

Alignment Length:951 Identity:296/952 (31%)
Similarity:435/952 (46%) Gaps:204/952 (21%)


  Fly   454 VPPGSNQHQLYRSQMASNP-RLQHIH--------HQTQQHQSLQVLPQ----------------P 493
            |||...| ..:||  ||.| ...|.|        |:....|....:.|                |
Zfish    38 VPPVKRQ-GFHRS--ASMPVETSHFHSPQRDIIDHRRAAFQRQSSITQTIKSSRRVHFERINTVP 99

  Fly   494 QNHHLSCKK------RIGMYMRRTTSQFFGVEPSTEAAD---------CALWQGRHRRLAIRCFG 543
            ...|.:.::      .:...:.|.|:.:|||....:|..         |:|..|:.:...||   
Zfish   100 IKGHRAGRRGFRRHQSLSRTLLRGTADWFGVSKDGDATQKWQRKSLRHCSLRYGKLKPQVIR--- 161

  Fly   544 MFDTELEYHMQQAIGGGNEDA-------GQSNG-------------------TNGNYAPDRPDIL 582
                |:|...|..|...:.:.       ...:|                   .:|...|..| |.
Zfish   162 ----EMELPSQDNISLTSTETPPPLYVPSSQHGMQKIVDPLARGRAFRMVEEVDGYSVPQTP-IT 221

  Fly   583 PVQDAI-GMDMTMSGDSR--RQKCYTNRDFLAGEFVERKASVGYMFVAMVSYLVHMFNKRRPI-- 642
            |...:| ..:.:.||.:|  |::              ::.||..|.....:.||    |.|.:  
Zfish   222 PGAASICSFNSSRSGLNRIPRRR--------------KRESVAKMSFRAAAALV----KGRSLRE 268

  Fly   643 ----QMHR-------------VRCPWQWSRSFAPIHVQSHSNQQTDADGCLTDGLEAIIDDEVFF 690
                :.||             |..|.:...||....:..|....|             ..||| |
Zfish   269 GTLRRAHRRSFTPASFIEEDVVDFPDELDTSFFARDIMMHEEMST-------------FHDEV-F 319

  Fly   691 DSPCEITTSAVN----DESSDIGRQAAKPRPCADQSGVGVSVYMAERQQNGWR-----TSALNSG 746
            :||.:.|...|:    |||...|       ...|:|.:..|..|...:: |||     |.|....
Zfish   320 ESPSDSTMKDVDSKQLDESELTG-------SALDKSELEKSHLMLPLER-GWRKVKEKTPAPPKI 376

  Fly   747 GNATSDINLTGDQSSHQPGAAHIPLCSSVSSQMQPAMRSSHSTTSTCNRGNRITAQLLDGVLENS 811
            ......:::.|.:...:.|   :|:....:.:.:|     :.........||...:.:|..::  
Zfish   377 RLKQEVVSVNGQRRGQRIG---LPVKKLFAREKRP-----YGLGMVGKLTNRTYRKRIDSYVK-- 431

  Fly   812 RRPPLRCIKYFSVNDLDDRTDHRPFFTYWINTVQVVVLILSIICYGIAPIGIGSEQKTGQVLVTS 876
                         ..::|..||||||||||..|.:::.||::..|||||:|....:....||...
Zfish   432 -------------KQIEDMDDHRPFFTYWITFVHILITILAVCIYGIAPVGFSQHETVDSVLRNK 483

  Fly   877 LSLQTVQHVEQRNLWIGPRNIDLVHMGAKFAACMRRDIKITEVVTKTRRHERETACCIRNDDSGC 941
            ...:.|:.|:|.|.||||.:..|:|:||||:.|||||.::.|::.|.:..||.:|||:|||.|||
Zfish   484 GVYENVKFVQQENFWIGPSSEALIHLGAKFSPCMRRDNQVHELIKKKQELERNSACCVRNDRSGC 548

  Fly   942 VQSSQAECSIRGLYPTKSISTWKKWSPSESGPG----GRISGSVCGLDPKFCDAPASIAPYEWPD 1002
            :|:|:.|||       .:::.|.||....|.|.    .|..||||..||:.|..|||::|:||||
Zfish   549 LQTSEEECS-------STLAVWVKWPQHPSVPQLDGVARQHGSVCHQDPRTCTEPASVSPHEWPD 606

  Fly  1003 DITKWPICRKTNSFTQRYRYKDHTS-EHMVCEVIGHPCCTGLYGECRITTREYCDFIKGYFHEEA 1066
            ||||||||.|.||       .:||: .|:.|.:.|.|||.|..|.|.||:||||||:||||||||
Zfish   607 DITKWPICTKYNS-------GNHTNLPHIDCTITGRPCCIGTKGRCEITSREYCDFMKGYFHEEA 664

  Fly  1067 SLCSQISCLNNVCGMFPFISVETPDQLYRLLTSLCMHAGILHLAITLIFQHLFLADLERLIGTVR 1131
            :||||:.|:::|||:.||::.|.|||.|||..||.:||||||..:::.||...|.|||:|.|.:|
Zfish   665 TLCSQVHCMDDVCGLLPFLNPEVPDQFYRLWLSLFLHAGILHCLVSVCFQMTILRDLEKLAGWLR 729

  Fly  1132 TAIVYIMSGFAGNLTSAILVPHRPEVGPSASLSGVVASLIALLVWMHWKYLHKPHIALFKLLLLC 1196
            .:|:||:||..|||.|||.:|:|.||||:.|..|::|.|...|: ..|:.|.:|..|..|||.:.
Zfish   730 ISIIYILSGITGNLASAIFLPYRAEVGPAGSQFGILACLFVELI-QSWQILAQPWRAFTKLLCVV 793

  Fly  1197 SVLVGIGTLPYQLNFLGLLAGVICGCLLTMSLVPFTTFSKYGR-KKKINLIWTCVLFHVVVYTAM 1260
            ..|...|.||:..|| ..::|.|.|..|:.:.:|:.:|.:... :|:..:|...|:| :.::..:
Zfish   794 LFLFAFGLLPWIDNF-AHISGFISGFFLSFAFLPYISFGRLDMYRKRCQIIIFLVVF-LGLFAGL 856

  Fly  1261 IVTFYIHPSE------FHSISFVDMFSNSNGYDNFTNADHH 1295
            :|.||:||.:      ...|.|.|.|...  ||  .||..|
Zfish   857 VVLFYVHPIKCEWCELLTCIPFTDKFCEK--YD--LNAHLH 893

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 62/135 (46%)
rhbdf1aXP_005164392.1 Rhomboid_SP 130..347 CDD:289371 50/264 (19%)
Rhomboid 685..826 CDD:279958 63/143 (44%)
DUF805 <792..864 CDD:294752 20/74 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002033
OrthoInspector 1 1.000 T596731
orthoMCL 1 0.900 OOG5_127224
Panther 1 1.100 O PTHR45965
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3334
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.