DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and RHBDL2

DIOPT Version :8

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_001291675.1 Gene:RHBDL2 / 54933 HGNCID:16083 Length:383 Species:Homo sapiens

Alignment Length:207 Identity:52/208 (25%)
Similarity:96/208 (46%) Gaps:33/208 (16%)


  Fly  1083 PFI-SVETPDQLYRLLTSLCMHAGILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLT 1146
            ||| |.|..::.:|.::.:.:|||:.|:...|..|.:....||.:...:|..:||:....||:|.
Human   189 PFIYSPEKREEAWRFISYMLVHAGVQHILGNLCMQLVLGIPLEMVHKGLRVGLVYLAGVIAGSLA 253

  Fly  1147 SAILVPHRPEVGPSASLSGVVASLIALLVWMHWKYLHKPHIALFKLLLLCSVLV-GIGTLPYQ-- 1208
            |:|..|.|..||.|..:..::.... :.|.::::.: .|...:|:||::..::| .:|...|:  
Human   254 SSIFDPLRYLVGASGGVYALMGGYF-MNVLVNFQEM-IPAFGIFRLLIIILIIVLDMGFALYRRF 316

  Fly  1209 --------LNFLGLLAGVICGCLLTMSLVPFTTFSKYGRK-KKINLIW-------TCVLFHVVVY 1257
                    ::|...:||...|    || :.:|.||.:.:. .|....|       .||||     
Human   317 FVPEDGSPVSFAAHIAGGFAG----MS-IGYTVFSCFDKALLKDPRFWIAIAAYLACVLF----- 371

  Fly  1258 TAMIVTFYIHPS 1269
             |:....::.|:
Human   372 -AVFFNIFLSPA 382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 34/146 (23%)
RHBDL2NP_001291675.1 Rhomboid 194..346 CDD:279958 39/159 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C83754947
eggNOG 1 0.900 E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.