DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and rpn1

DIOPT Version :8

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_989394.1 Gene:rpn1 / 395031 XenbaseID:XB-GENE-999954 Length:595 Species:Xenopus tropicalis

Alignment Length:184 Identity:34/185 (18%)
Similarity:61/185 (33%) Gaps:27/185 (15%)


  Fly  1253 HVVVYTAMIVTFYIHPSEFHS--ISFVDMFSNSNGYDNFTNADHHGVDVVSSNTRYSQTQNSQYY 1315
            |:...||.:......|...||  ::......:...|......|.....:....|:.......||.
 Frog    38 HLAKVTAEVTISNPGPGAVHSFLLALEPELGSRLAYLGVKGEDEEDGALEIQETKVKGKSGMQYT 102

  Fly  1316 YHHHSDDIIRKSVTFTEKALVSHILYPTAPRKTSAQQWQEVEYSRSFNHLSNY-----SDRIKKS 1375
            ....|..........|.:.:.:|:|.|...:.|.|:: |.|.:..:....|.|     :.|:|.:
 Frog   103 VRFGSSLAPGAKTKVTVETVFTHVLQPYPTQITQAEK-QFVTFEGNHYFFSPYPTKSQTTRVKLA 166

  Fly  1376 IGNISKLKQVFTSPIRFSNKNNHSNLM------------TELTSVHSENKQKYL 1417
            ..|:    :.:|   :..|.....:|:            .:|..||.||...:|
 Frog   167 SRNV----ETYT---KLGNPTRSEDLIEYGPFKDIAPWSQDLLKVHYENNSPFL 213

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958
rpn1NP_989394.1 Ribophorin_I 26..445 CDD:309646 34/185 (18%)
SMC_N <490..>584 CDD:330553
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2291
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.