DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and Parl

DIOPT Version :10

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_001005767.1 Gene:Parl / 381038 MGIID:1277152 Length:377 Species:Mus musculus


Alignment Length:77 Identity:18/77 - (23%)
Similarity:34/77 - (44%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly  1096 LLTSLCMHAGILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVPHRPEVGPS 1160
            :|.|...|..:.|:|..:.....|.:.:..::|..:...||:.:|...|..|.:........|||
Mouse   207 MLLSTFSHFSLFHMAANMYVLWSFSSSIVNILGQEQFVAVYLSAGVISNFVSYVCKVATGRYGPS 271

  Fly  1161 ASLSGVVASLIA 1172
            ...||.:.:::|
Mouse   272 LGASGAIMTVLA 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:426384 18/77 (23%)
ParlNP_001005767.1 Rhomboid 207..348 CDD:426384 18/77 (23%)

Return to query results.
Submit another query.