powered by:
Protein Alignment rho-5 and Parl
DIOPT Version :9
| Sequence 1: | NP_995679.1 |
Gene: | rho-5 / 2768944 |
FlyBaseID: | FBgn0041723 |
Length: | 1429 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001005767.1 |
Gene: | Parl / 381038 |
MGIID: | 1277152 |
Length: | 377 |
Species: | Mus musculus |
| Alignment Length: | 77 |
Identity: | 18/77 - (23%) |
| Similarity: | 34/77 - (44%) |
Gaps: | 0/77 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1096 LLTSLCMHAGILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVPHRPEVGPS 1160
:|.|...|..:.|:|..:.....|.:.:..::|..:...||:.:|...|..|.:........|||
Mouse 207 MLLSTFSHFSLFHMAANMYVLWSFSSSIVNILGQEQFVAVYLSAGVISNFVSYVCKVATGRYGPS 271
Fly 1161 ASLSGVVASLIA 1172
...||.:.:::|
Mouse 272 LGASGAIMTVLA 283
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0705 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.