DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and CG33303

DIOPT Version :10

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_995680.1 Gene:CG33303 / 2768916 FlyBaseID:FBgn0053303 Length:458 Species:Drosophila melanogaster


Alignment Length:202 Identity:40/202 - (19%)
Similarity:65/202 - (32%) Gaps:58/202 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1267 HPSEF--HSISFVDMFSNSNGYDNF-TNADHHGVDVVSSNTRYSQTQNSQYYYHHHSDDIIRKSV 1328
            ||.|.  :...||....|.:.|..: ||:....|.:.|||. .|.||...:       .:....:
  Fly   130 HPEEIRQNDKQFVKYTGNLHLYSKYRTNSQKTNVKLSSSNI-LSHTQVKPF-------SVSSNKI 186

  Fly  1329 T---------FTEKALVSH-------ILYPTAPRKTSAQQWQEVEYSRSF----------NHLSN 1367
            |         |:::.||.|       :...|..|......|..:....|.          ...|.
  Fly   187 TLGPYENVEAFSQEPLVIHYENSAPFVTVNTLERTLEISHWGNIAVQESIQMTHTGAKLKGSFSR 251

  Fly  1368 YSDRIKKSIGNISKLKQVFT------SPIRFSNKNNH---SNLMTELTSVHSENKQKY------- 1416
            | |..|:....::.||...|      |.:.:.:.|.:   ||:......:..|.:.::       
  Fly   252 Y-DFQKEGRSGLAALKSYKTYLPASASGVYYRDTNGNISTSNMNAVRDFIELELRPRFPLFGGWK 315

  Fly  1417 ----LGY 1419
                |||
  Fly   316 TQYTLGY 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:426384
CG33303NP_995680.1 Ribophorin_I 34..444 CDD:428028 40/202 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.