DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and Rhbdf2

DIOPT Version :8

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_001161152.1 Gene:Rhbdf2 / 217344 MGIID:2442473 Length:827 Species:Mus musculus

Alignment Length:918 Identity:274/918 - (29%)
Similarity:424/918 - (46%) Gaps:189/918 - (20%)


  Fly   436 SSMVSVQAKRLEG----GGNMAVPPGSNQHQLYRSQMASNPRLQHIHHQTQQHQSLQVLPQPQNH 496
            |::.||...||:.    ..::.:||..:|....:..|....|....:.::   .|||   :|:..
Mouse     9 SNLPSVSGSRLQSRKPPNLSITIPPPESQAPGEQDSMLPERRKNPAYLKS---VSLQ---EPRGR 67

  Fly   497 -HLSCKKRIG--------MYMRRTTSQFFGVEPSTEAADCALWQGR----HRRLAIRC---FGMF 545
             ....:||.|        ..:|::|:|:|||...        |:|:    |||....|   :|..
Mouse    68 WQEGAEKRPGFRRQASLSQSIRKSTAQWFGVSGD--------WEGKRQNWHRRSLHHCSVHYGRL 124

  Fly   546 ----DTELEYHMQQ----------------------AIGGGNEDAGQSNGTNGNYAPDRPDILPV 584
                ..|||...|:                      |.|.......:.:..:..:.|..|.:|.:
Mouse   125 KASCQRELELPSQEVPSFQGTESPKPCKMPKIVDPLARGRAFRHPDEVDRPHAAHPPLTPGVLSL 189

  Fly   585 QDAIGMDMTMSGDSRRQKCYTNRDFLAGEFVERKASVGYM-FVAMVSYLVHMFNKRRPIQMHRVR 648
            .....:....|...||                ::.||.:| |.|..:.|    ..|..:.....|
Mouse   190 TSFTSVRSGYSHLPRR----------------KRISVAHMSFQAAAALL----KGRSVLDATGQR 234

  Fly   649 CPWQWSRSFA-PIHVQSHSNQQTDADGCLTDGLEAIIDDEVFFDSPCEITTSAVND--ESSDIGR 710
            |. ...|||| |      |..:.||    .||.:..  |..||..  |..:|..:|  ||..:..
Mouse   235 CR-HVKRSFAYP------SFLEEDA----VDGADTF--DSSFFSK--EEMSSMPDDVFESPPLSA 284

  Fly   711 QAAK--PRPCADQSGVGVSVYMAERQQNGWRTSALNSGGNATSDINLTGDQSSHQPGAAHIPLCS 773
            ...:  |...:..|..||.:.:.|           .|||.|..            ||.       
Mouse   285 SYFRGVPHSASPVSPDGVHIPLKE-----------YSGGRALG------------PGT------- 319

  Fly   774 SVSSQMQPAMRSSHSTTSTCNRGNRITAQLLD------------GVLEN-SRRPPLRCIKYFSVN 825
                                .||.||.:::..            ||:.| ..|...|.|......
Mouse   320 --------------------QRGKRIASKVKHFAFDRKKRHYGLGVVGNWLNRSYRRSISSTVQR 364

  Fly   826 DLDDRTDHRPFFTYWINTVQVVVLILSIICYGIAPIGIGSEQKTGQVLVTSLSLQTVQHVEQRNL 890
            .|:....|||:||||:..|.:::.:|.|..|||||:|......|..||......::|::::|.|.
Mouse   365 QLESFDSHRPYFTYWLTFVHIIITLLVICTYGIAPVGFAQHVTTQLVLKNRGVYESVKYIQQENF 429

  Fly   891 WIGPRNIDLVHMGAKFAACMRRDIKITEVVTKTRRHERETACCIRNDDSGCVQSSQAECSIRGLY 955
            ||||.:|||:|:||||:.|:|:|.:|.::|.:.|..||.:.||::||.|||:|:.:.:||     
Mouse   430 WIGPSSIDLIHLGAKFSPCIRKDQQIEQLVRRERDIERTSGCCVQNDRSGCIQTLKKDCS----- 489

  Fly   956 PTKSISTWKKWSPSESGPGGRI-------SGSVCGLDPKFCDAPASIAPYEWPDDITKWPICRKT 1013
              ::::|:.||. :::||..:.       |..||..||:.|:.|||...:.|||||||||||   
Mouse   490 --ETLATFVKWQ-NDTGPSDKSDLSQKQPSAVVCHQDPRTCEEPASSGAHIWPDDITKWPIC--- 548

  Fly  1014 NSFTQRYRYKDHTS-EHMVCEVIGHPCCTGLYGECRITTREYCDFIKGYFHEEASLCSQISCLNN 1077
               |::.: .:||. .|:.|::.|.|||.|..|.|.|||||||:|:.|||||:|:||||:.||:.
Mouse   549 ---TEQAQ-SNHTGLLHIDCKIKGRPCCIGTKGSCEITTREYCEFMHGYFHEDATLCSQVHCLDK 609

  Fly  1078 VCGMFPFISVETPDQLYRLLTSLCMHAGILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFA 1142
            |||:.||::.|.|||.||:..||.:||||:|..::::||...|.|||:|.|..|.:|::|:||..
Mouse   610 VCGLLPFLNPEVPDQFYRIWLSLFLHAGIVHCLVSVVFQMTILRDLEKLAGWHRISIIFILSGIT 674

  Fly  1143 GNLTSAILVPHRPEVGPSASLSGVVASLIALLVWMHWKYLHKPHIALFKLLLLCSVLVGIGTLPY 1207
            |||.|||.:|:|.||||:.|..|::|.|...| :..|:.|.:|..|.|.|..:...|...|.||:
Mouse   675 GNLASAIFLPYRAEVGPAGSQFGLLACLFVEL-FQSWQLLERPWKAFFNLSAIVLFLFICGLLPW 738

  Fly  1208 QLNFLGLLAGVICGCLLTMSLVPFTTFSKYGRKKKINLIWTCVLFHVVVYTAMIVTFYIHPSEFH 1272
             ::.:..:.|.:.|.||..:.:|:.||....:.:|..||...:|....::.::::..||:|..:.
Mouse   739 -IDNIAHIFGFLSGMLLAFAFLPYITFGTSDKYRKRALILVSLLVFAGLFASLVLWLYIYPINWP 802

  Fly  1273 SISFVDMF 1280
            .|.::..|
Mouse   803 WIEYLTCF 810

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 55/134 (41%)
Rhbdf2NP_001161152.1 Rhomboid_SP 98..304 CDD:289371 51/248 (21%)
Rhomboid 619..760 CDD:279958 57/142 (40%)
GtrA 719..803 CDD:303012 21/84 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002033
OrthoInspector 1 1.000 T615981
orthoMCL 1 0.900 OOG5_127224
Panther 1 1.100 LDO PTHR45965
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.770

Return to query results.
Submit another query.