DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and rom-5

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_001379293.1 Gene:rom-5 / 190260 WormBaseID:WBGene00004404 Length:333 Species:Caenorhabditis elegans


Alignment Length:122 Identity:23/122 - (18%)
Similarity:44/122 - (36%) Gaps:35/122 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1057 FIKGYF---HEEASLCSQISCLNNVCGMFPFISVETPDQLYRLLTSLCMHAGILHLAITLIFQHL 1118
            |:..||   :...||||.                        :|.|...|:.|:||.:.:.....
 Worm   151 FMTRYFTNSYASKSLCSP------------------------MLLSAFSHSSIIHLGLNMYVLST 191

  Fly  1119 FLAD-LERLIGTVRTAIVY----IMSGFAGNLTSAILVPHRPEVGPSASLSGVVASL 1170
            |... :|:.:|..:....|    ::|.|...:..|::   |..:....:...::|:|
 Worm   192 FAPHIIEKFMGVEQFWSFYVTAAVVSSFVSIVDKAVV---RSPIRALGASGAILAAL 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 16/86 (19%)
rom-5NP_001379293.1 Rhomboid 169..310 CDD:419717 16/80 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.