DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and Rhbdl1

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:XP_008765759.1 Gene:Rhbdl1 / 117025 RGDID:620699 Length:433 Species:Rattus norvegicus


Alignment Length:170 Identity:46/170 - (27%)
Similarity:78/170 - (45%) Gaps:18/170 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1094 YRLLTSLCMHAGILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVPHRPEVG 1158
            :|.||.:.||.|:..|....:.|.:....||.:.|.:|.:::|:....||:||.:|.....|.||
  Rat   241 WRFLTYMFMHVGLEQLGFNALLQLMIGVPLEMVHGVLRISLLYLAGVLAGSLTVSITDMRAPVVG 305

  Fly  1159 PSASLSGVVASLIALLVWMHWKYLHKPHIALFKLLLLCSVLVGIG---------TLPY---QLNF 1211
            .|..:..:.::.:|.:| |:|..:..|:..|..:|.|..:...:|         .||.   |.:|
  Rat   306 GSGGVYALCSAHLANVV-MNWAGMRCPYKLLRMVLALVCMSSEVGRAVWLRFSPPLPASGPQPSF 369

  Fly  1212 LGLLAGVICGCLLTMSLVPFTTFSKYGRKKKINLIWTCVL 1251
            :..|||.:.|  ::|.|   |....|..:.:....|..||
  Rat   370 MAHLAGAVVG--VSMGL---TILRSYEERLRDQCGWWVVL 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 39/142 (27%)
Rhbdl1XP_008765759.1 Rhomboid 234..388 CDD:279958 42/152 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338196
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.