| Sequence 1: | NP_995679.1 | Gene: | rho-5 / 2768944 | FlyBaseID: | FBgn0041723 | Length: | 1429 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001254516.1 | Gene: | rhbdl1 / 100887821 | ZFINID: | ZDB-GENE-120529-2 | Length: | 396 | Species: | Danio rerio |
| Alignment Length: | 259 | Identity: | 55/259 - (21%) |
|---|---|---|---|
| Similarity: | 102/259 - (39%) | Gaps: | 66/259 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1061 YFHEEASLCSQISCLNNVCGMFPFISVET-----------------------PD----------- 1091
Fly 1092 ---QLYRLLTSLCMHAGILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVPH 1153
Fly 1154 RPEVGPSASLSGVVASLIALLVWMHWKYLHKPHIALFKLLLLCSVLVGIG---------TLPY-- 1207
Fly 1208 -QLNFLGLLAGVICGCLLTMSLVPFTTFSKYGRKKKINLIWTCVLFHVVVYTAMIVTFYIHPSE 1270 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| rho-5 | NP_995679.1 | Rhomboid | 1090..1225 | CDD:279958 | 39/160 (24%) |
| rhbdl1 | NP_001254516.1 | Rhomboid | 197..351 | CDD:279958 | 39/156 (25%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C170577609 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0705 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.740 | |||||