DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33282 and GAL2

Sequence 1:NP_001097067.1 Gene:CG33282 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_013182.1 Gene:GAL2 SGDID:S000004071 Length:574 Species:Saccharomyces cerevisiae

Alignment Length:500 Identity:109/500 (22%)
Similarity:197/500 (39%) Gaps:115/500 (23%)


  Fly    27 ITFGHGVGVGWLSPTLT--KIQTADSPLDF-------------EVNLAQISWLGSMLGLDSLCGN 76
            :.|| |...||.:.|::  .:||     ||             .::..:...:.::..:....|.
Yeast    78 VAFG-GFMFGWDTGTISGFVVQT-----DFLRRFGMKHKDGTHYLSNVRTGLIVAIFNIGCAFGG 136

  Fly    77 LTIAMLIERAGRKFCLYLMAGPYACIWILIYCAS-NVYYLY-AARFLCGFTGGAGYLVVPIFISE 139
            :.::...:..|||..|.::...| .:.|:|..|| |.:|.| ..|.:.|...|...::.|:.|||
Yeast   137 IILSKGGDMYGRKKGLSIVVSVY-IVGIIIQIASINKWYQYFIGRIISGLGVGGIAVLCPMLISE 200

  Fly   140 VADSNIRGALTSMVMLSVDLGILAGYI-------LSTYLAYHVVPFLAIILPVAYFIANIMLPET 197
            :|..::||.|.|...|.:..||..||.       .|..:.:.|...|.....:....|..::||:
Yeast   201 IAPKHLRGTLVSCYQLMITAGIFLGYCTNYGTKSYSNSVQWRVPLGLCFAWSLFMIGALTLVPES 265

  Fly   198 APYLLKKSQLAAAENSFRYYRNQRSAICEQTSKVNFEELRTAVLS---------QQTRNATPLSY 253
            ..||.:.:::..|:.|.           .:::||:.|:  .||.:         :..:.|...|:
Yeast   266 PRYLCEVNKVEDAKRSI-----------AKSNKVSPED--PAVQAELDLIMAGIEAEKLAGNASW 317

  Fly   254 KDL--TTKPALKGFAASIVLSLGYQFSGVFSFINYMSDIFKASGSVVDVNTATIIIGLVQIVGVY 316
            .:|  |.....:.....:.:.:..|.:|...|..|.:.|||:.| :.|....:|:||:|.....:
Yeast   318 GELFSTKTKVFQRLLMGVFVQMFQQLTGNNYFFYYGTVIFKSVG-LDDSFETSIVIGVVNFASTF 381

  Fly   317 TSTILVDIVGRRVLMLI----------------------------STMGVGIGCIAFGCFTYLAK 353
            .|...|:.:|.|..:|:                            |:.|.|...|.|.||     
Yeast   382 FSLWTVENLGHRKCLLLGAATMMACMVIYASVGVTRLYPHGKSQPSSKGAGNCMIVFTCF----- 441

  Fly   354 IYDLSDFNWLPLVLMIIICYVANIGLIGIFFLVLVELFPVKIRS----LATSLSVIFLSLLVFGT 414
                           .|.||......:.  :::..|.||::::|    ||::.:.::..|:.|.|
Yeast   442 ---------------YIFCYATTWAPVA--WVITAESFPLRVKSKCMALASASNWVWGFLIAFFT 489

  Fly   415 LKLFPLMLHYWGISFTMWFSAASALLTFFYFWLFLQETKGKSMIE 459
            ..:...:..|:|..|     ....:..|||.:.|:.||||.|:.|
Yeast   490 PFITSAINFYYGYVF-----MGCLVAMFFYVFFFVPETKGLSLEE 529

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33282NP_001097067.1 MFS 21..448 CDD:119392 102/488 (21%)
MFS_1 53..409 CDD:284993 85/421 (20%)
GAL2NP_013182.1 Sugar_tr 74..534 CDD:278511 109/500 (22%)
MFS 75..518 CDD:119392 102/488 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C97245782
eggNOG 1 0.900 E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T133782
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.