DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33282 and SFP2

Sequence 1:NP_001097067.1 Gene:CG33282 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001330511.1 Gene:SFP2 AraportID:AT5G27360 Length:526 Species:Arabidopsis thaliana

Alignment Length:474 Identity:123/475 (26%)
Similarity:204/475 (43%) Gaps:42/475 (9%)


  Fly     5 LKNSLLQQK----------TRYQLLATVIVNIITFGHGVGVGWLSPTLTKIQTADSPLDFEVNLA 59
            ::..|||.|          |...:|:|.|....:|..||.:|:.|.....|..     |.::::|
plant    61 IEERLLQLKNQNDDSECRITACVILSTFIAVCGSFSFGVSLGYTSGAEIGIMK-----DLDLSIA 120

  Fly    60 QISWLGSMLGLDSLCGNLTIAMLIERAGRKFCLYLMAGPYACI--WILIYCASNVYYLYAARFLC 122
            |.|...|:..|.:..|.|....:....||:..:::  ....||  |..|..|.:|.:|...|...
plant   121 QFSAFASLSTLGAAIGALFSGKMAIILGRRKTMWV--SDLLCIIGWFSIAFAKDVMWLNFGRISS 183

  Fly   123 GFTGGAGYLVVPIFISEVADSNIRGALTSMVMLSVDLGILAGYILSTYLAYHVVPFLAIILPVAY 187
            |...|....|||::|:|::..::||..|....|..:.|:...|....:|.:.::..|..:.....
plant   184 GIGLGLISYVVPVYIAEISPKHVRGTFTFTNQLLQNSGLAMVYFSGNFLNWRILALLGALPCFIQ 248

  Fly   188 FIANIMLPETAPYLLKKSQLAAAENSFRYYRNQRSAICEQTSKVNFEELRTAVLSQQTRNATPLS 252
            .|....:||:..:|.|.......|||....|...:.|..:.|.:.       |:::...|.:..|
plant   249 VIGLFFVPESPRWLAKVGSDKELENSLLRLRGGNADISREASDIE-------VMTKMVENDSKSS 306

  Fly   253 YKDLTTKPALKGFAASIVLSLGYQFSGVFSFINYMSDIFKASGSVVDVNTATIIIGLVQIVGVYT 317
            :.||..:.........|.|.|..||||..:.::|.|.|.:.:|..|.:.:.  ::||..|.....
plant   307 FCDLFQRKYRYTLVVGIGLMLIQQFSGSSAVLSYASTILRKAGFSVTIGST--LLGLFMIPKAMI 369

  Fly   318 STILVDIVGRRVLMLISTMGVGIGCIAFGCFTYLAKIYDLSDFNWLPLVLMI-IICYVAN--IGL 379
            ..||||..|||.|:|.|..|:.|..:..|....|.|:..|.:..  |:...| :..|:..  |||
plant   370 GVILVDKWGRRPLLLTSVSGMCITSMLIGVAFTLQKMQLLPELT--PVFTFICVTLYIGTYAIGL 432

  Fly   380 IGIFFLVLVELFPVKIR----SLATSLSVIFLSLLVFGTLKLFPLMLHYWGISFTMWFSAASALL 440
            .|:.::::.|:||:.|:    |:.|.:|....|::.:.    |..:|. |....|.:...|...|
plant   433 GGLPWVIMSEIFPMNIKVTAGSIVTLVSWSSSSIVTYA----FNFLLE-WSTQGTFYVFGAVGGL 492

  Fly   441 TFFYFWLFLQETKGKSMIE 459
            ...:.||.:.||||.|:.|
plant   493 ALLFIWLLVPETKGLSLEE 511

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33282NP_001097067.1 MFS 21..448 CDD:119392 111/436 (25%)
MFS_1 53..409 CDD:284993 95/365 (26%)
SFP2NP_001330511.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D430696at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23500
Phylome 1 0.910 0.932 Consistency score
33.020

Return to query results.
Submit another query.