DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33282 and CG1213

Sequence 1:NP_001097067.1 Gene:CG33282 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001246937.1 Gene:CG1213 FlyBaseID:FBgn0037387 Length:491 Species:Drosophila melanogaster

Alignment Length:453 Identity:127/454 (28%)
Similarity:230/454 (51%) Gaps:23/454 (5%)


  Fly    19 LATVIVNIITFGHGVGVGWLSPTLTKIQ---TADSPLDFEVNLAQISWLGSMLGLDSLCGNLTIA 80
            :|.|..|:..|..|..:||.||...|::   |:||||...:...:.:|:.|::.:.:|.......
  Fly    44 MAAVAANLSAFVVGTTLGWTSPIGPKLKSEDTSDSPLSRPITSDEDAWISSLIAVGALVAPFVAG 108

  Fly    81 MLIERAGRKFCLYLMAGPYACIWILIYCASNVYYLYAARFLCGFTGGAGYL--VVPIFISEVADS 143
            .:.:|.|||:.|...:..:...:.|...||.|:.||.:|.:.||  |.|::  |.|:::.|::..
  Fly   109 PMADRIGRKWVLLSSSLFFVLAFGLNMVASEVWILYMSRLIQGF--GVGFVMTVQPMYVGEISTD 171

  Fly   144 NIRGALTSMVMLSVDLGILAGYILSTYLAYHVVPFLAIILPVAYFIANIMLPETAPYLLKKSQLA 208
            |:|||..|::.|.:..|||..|.:..|::|..:.:..|::||.:.:...|:||:..:...|.:.:
  Fly   172 NVRGATGSLMQLFIVGGILYVYAIGPYVSYQALQWCCIVVPVVFDLVFYMMPESPYFFAGKGRKS 236

  Fly   209 AAENSFRYYRNQRS-AICEQTSKV--NFEELRTAVLSQQTRNATPLSYKDLTTKPALKGFAASIV 270
            .|..|.::.|.|.: .:.::.:::  |.||      :..::......:|:...:.||  |..:.:
  Fly   237 EALKSLQFLRGQSAEGVHDEMAEIQANVEE------AMASKGTVMDLFKNAGNRRAL--FICAGL 293

  Fly   271 LSLGYQFSGVFSFINYMSDIFKASGSVVDVNTATIIIGLVQIVGVYTSTILVDIVGRRVLMLIST 335
            :|. .|.||:...:.....||.::.:.:|...||||||.||:.....:.::.|.:||:|::|.|:
  Fly   294 ISF-QQLSGINVVLFNSQSIFASANTGLDPAIATIIIGCVQVGSSALTPLVADRLGRKVMLLTSS 357

  Fly   336 MGVGIGCIAFGCFTYLAKIY-DLSDFNWLPLVLMIIICYVANIGLIGIFFLVLVELFPVKIRSLA 399
            ..:.||..|.|.|.|:..:. |:|...|:|:..:||...|...|...:.:.||.|:||..|:|:|
  Fly   358 SVMSIGLAALGAFFYMQLVKGDISSVVWMPVPALIIYNIVYCTGFGPLPWAVLGEMFPANIKSVA 422

  Fly   400 TSLSVIFLSLLVFGTLKLFPLMLHYWGISFTMWFSAASALLTFFYFWLFLQETKGKSM--IED 460
            :|:.......|.|.....:| .|...|..:..|..|...::.||:....:.||||.|:  |:|
  Fly   423 SSVVASTCWTLGFLVTFFYP-SLDALGSYYAFWLFAVCMVVAFFFVLFVVMETKGLSLQQIQD 484

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33282NP_001097067.1 MFS 21..448 CDD:119392 119/436 (27%)
MFS_1 53..409 CDD:284993 96/362 (27%)
CG1213NP_001246937.1 SP 42..482 CDD:273317 125/450 (28%)
MFS 47..460 CDD:119392 117/425 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D430696at2759
OrthoFinder 1 1.000 FOG0000041
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23500
RoundUp 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.