DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33282 and CG32054

Sequence 1:NP_001097067.1 Gene:CG33282 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_729588.1 Gene:CG32054 FlyBaseID:FBgn0052054 Length:563 Species:Drosophila melanogaster

Alignment Length:506 Identity:98/507 (19%)
Similarity:171/507 (34%) Gaps:175/507 (35%)


  Fly    57 NLAQISWLGSMLGLDSLCGNLTIAMLIERAG--------RKFCLYLMAGPYACI--WILIYCASN 111
            |..|.:.:|: .||..:.|.:.||..|...|        ..|..:.:.|....:  |.||...:.
  Fly   117 NKPQSNAVGA-AGLIFVSGGMNIAWSIGFRGVLHYKTTEHNFAAWFIGGIIGAVISWFLINNVAK 180

  Fly   112 VYYL------------------------YAARFLCGFTGGAGYLVVPIFISEVADSNIRGALT-S 151
            .|.|                        .||.:|.|...|..:........||:.|.:||.:: |
  Fly   181 KYVLIFSSFLVMIGGILTTSTKNSGDATLAASYLDGIANGLVFAPFMALAGEVSVSYMRGMVSAS 245

  Fly   152 MVMLSVDLGILAGYILST------YLAYH-------------VVPFLAIILPVAYFIANIMLPET 197
            :..:...|||....|.::      |.:|:             :..|||:|      |.:::..|:
  Fly   246 IEQMCFGLGIFLQIIYTSTWNSTAYPSYNSFSAENMKGVLSIIYGFLALI------IGSLLCIES 304

  Fly   198 APYLL-KKSQLAAAENSFRYYRNQRS-AICEQTSKVNFEEL----------RTAVLSQQTRNATP 250
            ...:| |.:....|.::.|  |.||. .:..:|    ||:|          :...:.|....|.|
  Fly   305 PVIMLAKNNDEQGAIDALR--RLQRPYTLTNET----FEQLAEHKKYLAQNKELSMGQSIGQALP 363

  Fly   251 LSYKDLTTKPALKGFAASIVLSLG--YQFSGVFSFINYMSDIFKASGSVVDVNTATIIIGLVQIV 313
             ::..|.....|...:.|..:.:|  |.|:..:.:::.....|             |..|:.:.:
  Fly   364 -TFIRLVFLRGLNAMSISKFVMIGFVYSFASPYGYVSPSVGWF-------------IGFGVCRWM 414

  Fly   314 GVYTSTILVDIVGRRVLMLISTMGVGIGCIAFGCFTYLAKIYDLSDFNWLPLVLMIIICYVANIG 378
            |.:.:|..::..||:                                  .|.:|.:|:|.|.:..
  Fly   415 GNFIATFCMESCGRK----------------------------------KPTLLGLIVCSVMSFV 445

  Fly   379 LIGIF-----------FLVLVELFPVKIRSLATSLSVIFLSLLVFGTLKLFPLMLHYWGISFTM- 431
            :.|.|           .|::.|||    ..:|.:.:..:||       :.|||.:....||||. 
  Fly   446 VAGQFNIFTYNTGNNIMLLVFELF----AGIAFTATSPYLS-------EAFPLEVKQHFISFTFI 499

  Fly   432 -------------WFSAASA----------LLTFFYFWLFLQETKGKSMIE 459
                         |.|:..|          |..||:..:.|.||:..::.|
  Fly   500 GEMLVFLVLTLIRWSSSGGANYFYVMGGLYLFGFFFGLVCLPETRRTTLRE 550

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33282NP_001097067.1 MFS 21..448 CDD:119392 94/494 (19%)
MFS_1 53..409 CDD:284993 81/431 (19%)
CG32054NP_729588.1 Pro-rich <7..101 CDD:291893
MFS 157..539 CDD:119392 84/453 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C97039255
eggNOG 1 0.900 E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.