DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33282 and C35A11.4

Sequence 1:NP_001097067.1 Gene:CG33282 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_504430.2 Gene:C35A11.4 WormBaseID:WBGene00016431 Length:515 Species:Caenorhabditis elegans

Alignment Length:434 Identity:109/435 (25%)
Similarity:196/435 (45%) Gaps:68/435 (16%)


  Fly    62 SWLGSMLGLDSLCGNLTIAMLIERAGRKFCLYL------MAGPYACIWILIYCASN---VYYLY- 116
            |::.::|.|.:|.|:.:|.::.:..|||..||:      :||..:       .||.   ::.|| 
 Worm    64 SFVVAILFLGALAGSFSIRLIADWIGRKNGLYISIAVGVLAGGMS-------IASKFIPLFELYI 121

  Fly   117 AARFLCGFTGGAGYLVVPIFISEVADSNIRGALTSMVMLSVDLGILAGYILST----------YL 171
            |:|.:.|::......:..:|:||.:....|||:..|....|.||.:.|.:::.          :|
 Worm   122 ASRIVMGWSVSVSLGLSALFLSEASPKQNRGAIGMMTGTCVQLGTVCGSVIAMPQIFGTEDLWWL 186

  Fly   172 AY----HVVPFLAIILPVAYFIANIMLPETAPYLLKKSQLAAAENSFRYYRNQRSAICEQTSKVN 232
            .|    .::.|....||        ..||:..:|:::....||..|..||.|     ||    ::
 Worm   187 IYATEIGIMLFFGAALP--------FFPESPGFLIQRGATEAATKSIAYYYN-----CE----ID 234

  Fly   233 FEELRTAVLSQQTRNATPLSYK--DLTTKPALKGFA-ASIVLSLGYQFSGVFSFINYMSDIFKAS 294
            ..|.....:.::.:|:|. ::|  |:..|.:|:..| ..:|::....||||.....:..||.|.:
 Worm   235 EAEKHLNEIKEEQKNSTK-NFKMMDIVRKKSLRDKAFIGVVVTFAMSFSGVAVINAFAFDILKDT 298

  Fly   295 G-SVVDVNTATIIIGLVQIVGVYTSTILVDIVGRRVLMLISTMGVGI-GCIAFG-CFTYLAKIYD 356
            | .|::.:.|...|.:|.::....:.::||..|||.|:|||..|:.: ..|.|. .||:    |.
 Worm   299 GLKVLEASLANDAISVVSMISSIVAAVIVDRNGRRPLLLISFAGILVCNLIIFALMFTF----YK 359

  Fly   357 LSDFNWLPLVLMIIICYVANIGLIG---IFFLVLVELFPVKIRSLATSLSVIFLSLLVFGTLKLF 418
            ..: :.|..:|:..||.......:|   :.:.:..||.....||.|.|.:.:...|..|..:..|
 Worm   360 FEN-HVLGFILICFICIFTFFFALGPGPLCYFINAELVGQAARSAAQSWASVIQMLSRFVIVTAF 423

  Fly   419 PLMLHYWGISFT---MWFSAASALLTFFYFWLFLQETKGKSMIE 459
            ..|.:..|.:::   ::.:..:|.|.:.||  .|.|||.|:..|
 Worm   424 LPMKNQLGEAWSYLILFVAPVAASLVYLYF--SLPETKNKNPFE 465

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33282NP_001097067.1 MFS 21..448 CDD:119392 103/422 (24%)
MFS_1 53..409 CDD:284993 94/380 (25%)
C35A11.4NP_504430.2 Sugar_tr 12..469 CDD:278511 109/435 (25%)
MFS 64..453 CDD:119392 102/419 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C97036963
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000041
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.