DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33282 and CG42826

Sequence 1:NP_001097067.1 Gene:CG33282 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001189079.1 Gene:CG42826 FlyBaseID:FBgn0262008 Length:473 Species:Drosophila melanogaster

Alignment Length:501 Identity:104/502 (21%)
Similarity:183/502 (36%) Gaps:118/502 (24%)


  Fly     2 ATFLKNSLLQQKTRYQLLATVIVNIITFGHGVGVGWLSPTLTKIQTADSPLDFEVNLA------- 59
            ||||:   |..|...|..|....:.|....|:.:.|             ...|.|:.|       
  Fly    20 ATFLR---LGHKNHSQWTALGSASFILISGGMSLAW-------------GAGFAVHSAHRDQLLR 68

  Fly    60 ----QISW-----LGSMLGLDSLCGNLTIAMLIERAGRKFCLYLMAGPYACIWI---LIYCASNV 112
                ||:|     ||::.|                     ..|....|...|:|   ::..||.:
  Fly    69 TVHMQIAWYATAVLGALFG---------------------AFYTHRLPQQPIYIFSSILVIASGI 112

  Fly   113 YYL---------YAARFLCGFTGGAGYLVVPIFISEVADSNIRGALTSMV-MLSVDLGILAGYIL 167
            .:|         .|||:|.|...|..::.....:.|::.:.|||.|.|.| .||.:.|||...|.
  Fly   113 LFLAWPECPGAIIAARYLDGLANGLVFVPALSTVGEISVNEIRGLLASTVEQLSFNTGILLQLIY 177

  Fly   168 S---------TYLAYHVVPFLAIILPV-AYFIANIMLPETAPYLLKKSQLAAAENSFRYYRNQRS 222
            :         ..:|..|...|:|:..| |..:|..:..|:..:||.:|....|..:.|:.  ||.
  Fly   178 TAVWQVDWNVAIVADQVHGVLSIVYGVIALALALTLCVESPVHLLMRSSEQRALVALRHL--QRP 240

  Fly   223 AICEQTSKVNFEELRTAVLSQQTRNATPLSYKDLTTKPALKGFAASIVLSLGYQFSGVFSFINYM 287
            .:......:..:|.:..|...          :::....:|:....|::..|..:..||.|..:.:
  Fly   241 YMVTSEMLLRLDEHKQYVADN----------REMCLGSSLQKGYPSVLKLLALRLLGVLSLNSII 295

  Fly   288 -SDIFKASGSVVDVNTA--TIIIGLVQIVGVYTSTILVDIVGRRVLMLISTMGVGIGCIAFG--- 346
             |.:::....:|....|  .::.||::..|.:.:.:|:|..||:...|......|...||:.   
  Fly   296 CSALYETGNQLVSCLYAWPFVVFGLLRWGGCFFAVLLMDTTGRKKPTLFGIFSTGAFAIAYANLF 360

  Fly   347 -----CFTYLAKIYDLSDFNWL-------------PLVL---MIIICYVAN--IGLIGIFFLVLV 388
                 ..|.|..::.|..|..|             ||::   |:.:.|:..  ..|:...||..:
  Fly   361 GRTPHMITALVMLFSLQFFEGLGQCASAVYLTEGFPLLMKPHMVAVVYIMEQAARLLLCSFLPSI 425

  Fly   389 ELFPVKIRSLATSLSVIFLSLLVFGTLKLFPLMLHYWGISFTMWFS 434
            ........|:. :||::...|.:|...:...:.|....:.|:.||:
  Fly   426 AEITAYFHSMG-ALSMVCFLLGIFCLPETRLVTLAEAQLKFSKWFN 470

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33282NP_001097067.1 MFS 21..448 CDD:119392 96/483 (20%)
MFS_1 53..409 CDD:284993 87/424 (21%)
CG42826NP_001189079.1 Sugar_tr 80..465 CDD:278511 84/419 (20%)
MFS 310..>459 CDD:119392 30/150 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C97039412
eggNOG 1 0.900 E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.