DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33282 and slc2a12

Sequence 1:NP_001097067.1 Gene:CG33282 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster
Sequence 2:XP_004914644.1 Gene:slc2a12 XenbaseID:XB-GENE-1012136 Length:577 Species:Xenopus tropicalis

Alignment Length:555 Identity:112/556 (20%)
Similarity:196/556 (35%) Gaps:160/556 (29%)


  Fly    18 LLATVIVNIITFGHGVGVGWLSPTLTKIQTADSPLDFEVNLAQISWLGSMLGLDSLCGNLTIAML 82
            ||::||..:.....|..:|.:|..|.::|:.     .|:...|...:.|.|.:.:...:|....|
 Frog    35 LLSSVIAAVSGLLVGYELGIISGALLQLQSL-----LELTCQQQEIVVSALLIGAFVASLVGGSL 94

  Fly    83 IERAGRKFCLYLMAGPYACIWILIYCASN------VYY--LYAARFLCGFTGGAGYLVVPIFISE 139
            |:..||:..:...:        ::...||      |.|  |.|.|.:.|.:.....:...::|:|
 Frog    95 IDLYGRRITIIFTS--------ILLVFSNLLPVVIVSYGSLIAGRIVIGVSISLSAIATCVYIAE 151

  Fly   140 VADSNIRGALTSMVMLSVDLGILAGYILSTYLAYHVVP----FLAIILPVAYF--IANIMLPETA 198
            ::..:.||.|.|:..|.:.:|||..||.: ||...|..    ...:|:|:|..  ||...||::.
 Frog   152 ISPQHKRGMLVSLNELMIVVGILFAYICN-YLFASVSNGWKYMFGLIIPLAALQAIAMYFLPQSP 215

  Fly   199 PYLLKKSQLAAAENSFRYYRNQRSAICEQTSKVNFEELRTAVLSQ-----QTRNATPLSYKDLTT 258
            .:|:.|....||....:..|          :..|..|..||:.|.     |.|.......:|...
 Frog   216 RFLIMKGYDDAAGKVLQKLR----------ATTNISEELTAIKSSIKAEYQYRFLDLFCSRDNMR 270

  Fly   259 KPALKGFAASIVLSLGYQFSGVFSFINYMSDIFKASG--SVVDVNTATIIIGLVQIVGVYTSTIL 321
            ...|.|    :.||...|.:|..:.:.|.|.:.|:.|  |....:.|:..||::::|....:.|.
 Frog   271 VRLLIG----LTLSFFVQITGQPNILFYASTVLKSVGFQSTEAASLASTGIGVIKVVSTIPAIIF 331

  Fly   322 VDIVGRRVLMLISTMGVGIGCIAFGC--------FTYLAKIYD---------------------- 356
            ||.:|.:..:.|.:..:.:..::.|.        |..:.|::.                      
 Frog   332 VDKIGSKTFLCIGSAVMAVSLVSVGLVSLQLDVNFNNICKVHTMQNHSLQDSIIYGPLSLSKPNE 396

  Fly   357 ----------------LSDFN-------------------------------------WLPLVLM 368
                            ||..|                                     ||.|..:
 Frog   397 SLFEETSTLESTKASYLSPLNGTKSWHFTTQEVDSSIGVTPKETKIKSQPDGIPEYMKWLCLASL 461

  Fly   369 IIICYVANIGLIGIFFLVLVELFPVKIRSLATSLS---------VIFLSLLVFGTLKLFPLMLHY 424
            :......:|||..:.:||..|:||..|:..|.:::         :|.|:.|....:...|.||  
 Frog   462 LAFVAAFSIGLGPMAWLVQSEIFPAGIKGRAFAITSSMNWGMNLLISLTFLTLTEIIGLPWML-- 524

  Fly   425 WGISFTMWFSAASALLTFFYFWLFLQETKGKSMIE 459
                             |.|..:.:..|||:.:.|
 Frog   525 -----------------FGYALMSVPNTKGRPLEE 542

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33282NP_001097067.1 MFS 21..448 CDD:119392 106/540 (20%)
MFS_1 53..409 CDD:284993 93/469 (20%)
slc2a12XP_004914644.1 Sugar_tr 38..544 CDD:278511 110/553 (20%)
MFS 39..>359 CDD:119392 80/348 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C96962704
eggNOG 1 0.900 E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.