DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33298 and ALA2

Sequence 1:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_568633.2 Gene:ALA2 AraportID:AT5G44240 Length:1139 Species:Arabidopsis thaliana

Alignment Length:1273 Identity:363/1274 (28%)
Similarity:582/1274 (46%) Gaps:297/1274 (23%)


  Fly   253 NKIRTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLN-W-----VPEISAFGKEVAMIPVLFVLG 311
            |:|...||||.:|:||||.|||.|..|.||:.|..|. |     |...|.:|      |::|:..
plant    52 NRISNRKYTLWNFLPKNLWEQFSRFMNQYFLLIACLQLWSLITPVNPASTWG------PLIFIFA 110

  Fly   312 VTAVKDLFEDRRRRASDKRINNTTCRVYDGETERYKKVKWQELRVGDIVHLSNNETVPADILLLR 376
            |:|.|:.::|..|..|||:.|..  .|:..:....|.::.|:::||:||.|..|:.||.|::||.
plant   111 VSASKEAWDDYHRYLSDKKANEK--EVWIVKQGIKKHIQAQDIQVGNIVWLRENDEVPCDLVLLG 173

  Fly   377 TSDPQGVCYIDTCDLDGETNLKRREV--------VRGFEEMQSIF---VPSKFVSRVEADAPTTK 430
            |||||||||::|..|||||:||.|.:        :....:|:.:.   ||.|.:.|.:|:.    
plant   174 TSDPQGVCYVETAALDGETDLKTRVIPSACVGIDLELLHKMKGVIECPVPDKDIRRFDANM---- 234

  Fly   431 LYRFHGALIHP--TGERVPISTECLLLRESRLKNTDYIEGIVVYAGHETKSMLNN--SGPRYKR- 490
                  .|..|  ..:...::.:..||:...|:||::..|:.||.|::||..::.  :.|:... 
plant   235 ------RLFPPFIDNDVCSLTIKNTLLQSCYLRNTEWACGVSVYTGNQTKLGMSRGIAEPKLTAM 293

  Fly   491 -SQVEQQMNIDVIWCVIILLILCVVGAI-----GCRMWLSSFTHFP--VPYLPPNKLTANMESMW 547
             :.:::......::.::::|:|.:.|.:     ..:.|   :..:|  .|:         .|.:.
plant   294 DAMIDKLTGAIFVFQIVVVLVLGIAGNVWKDTEARKQW---YVQYPEEAPW---------YELLV 346

  Fly   548 IFWTYIVILQVMIPLSLYVTIELCKILQVFHIHNNVDLFDAETNKQTECRAMNITEELGQIQHIF 612
            |...:.::..:|||:|:.|:::|.|.|....|..:|::.|.||...:......|:|:|||:::|.
plant   347 IPLRFELLCSIMIPISIKVSLDLVKGLYAKFIEWDVEMIDQETGTASYAANTAISEDLGQVEYIL 411

  Fly   613 TDKTGTLTENKMIFRRCVVNGSDYNHPPSELEKIYSKPGAPAPPLIPNDNLNSDM---AQLTQGT 674
            ||||||||:||||||||.:.|..|.                        |.|.|.   |||... 
plant   412 TDKTGTLTDNKMIFRRCCIGGIFYG------------------------NENGDALKDAQLLNA- 451

  Fly   675 YLTPHAQRIQEFLVVLAICNTVIVGAAPHRDMMNASGIIEVQQIGNSPANLKHGKQRQKLLASST 739
             :|..:..:..||.|:||||||                                           
plant   452 -ITSGSTDVIRFLTVMAICNTV------------------------------------------- 472

  Fly   740 STTTTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQPTLSPISSSAES 804
                                                          ||.|               
plant   473 ----------------------------------------------LPVQ--------------- 476

  Fly   805 SPNSESESPSPPMKNKSLSNSISPTGRAKAVINSKITSIATFLNAKTQGKRMKLPSSKTGTIYRT 869
                                                                    ||.|.|   
plant   477 --------------------------------------------------------SKAGDI--- 482

  Fly   870 ADGRPLYEAESPDELALVNAAYSYDCCLLNRSPNQILVSMPMAGATREYEILKVLPFDSSRKCMS 934
                 :|:|:|.||.|||.||.......:.::.|  |:.:...|:...||:|::|.|.|.||.||
plant   483 -----VYKAQSQDEDALVIAASKLHMVFVGKNAN--LLEIRFNGSVIRYEVLEILEFTSDRKRMS 540

  Fly   935 IVVRQIGSQEIVLYTKGADSSIMPVLVPCSHNSPEGILREQTQQL---LDRYAREGLRILVMAKR 996
            :||:...:.:|:|.:||||.:|:|.       :..|   :||:.:   ::.|::.|||.|.:|.|
plant   541 VVVKDCQNGKIILLSKGADEAILPY-------ARAG---QQTRTIGDAVEHYSQLGLRTLCLAWR 595

  Fly   997 TLNSADYTDWWARHQEIEMSLENRERRLRDSFAKLESNLTLLGATGIEDRLQDGVPETIASLLSA 1061
            .|...:|.:|..:.:|....|.:||.|:.:...:||.:|.:||.|.|||||||||||||.:|..|
plant   596 ELEENEYLEWSVKFKEASSLLVDREWRIAEVCQRLEHDLYILGVTAIEDRLQDGVPETIETLRKA 660

  Fly  1062 GISVWVLTGDKPETAINIAYSAKLFTQQM--ELIRLTARSRDAAETAINFYLTDMENDKTTSTLG 1124
            ||:.|:|||||..|||.||.|....:.:.  :|:.:..::.:....::...|..|   :.|::  
plant   661 GINFWMLTGDKQNTAIQIALSCNFISPEPKGQLLMIDGKTEEDVSRSLERVLLTM---RITAS-- 720

  Fly  1125 YGQSLRKKQRALVVDGKTLTFILDPKSKLILPFLRLSKRCASVLCCRSTPLQKAYLVKVVKEELN 1189
                 ..|..|.|:||..|...|....|   .|:.|:....:.:|||.||.|||.||:::| ..:
plant   721 -----EPKDVAFVIDGWALEIALKHHRK---DFVELAILSRTAICCRVTPSQKAQLVEILK-SCD 776

  Fly  1190 LRTLAIGDGANDVSMIQMADVGVGISGQEGMQAVMAADFTLPRFRYLERLLLAHGYWCYDRLSRM 1254
            .||||||||.|||.|||.||:||||||:||:||..|||:::.|||:|:||:|.||.:.|:|.:.:
plant   777 YRTLAIGDGGNDVRMIQQADIGVGISGREGLQAARAADYSIGRFRFLKRLILVHGRYSYNRTAFL 841

  Fly  1255 ILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMYLMLYNLIFTSLPPLAIGVYDKRVAEDLLLKN 1319
            ..|.|||:....|:..::....|.||..:.:.:.||.||:.:||:|.| :.|.||.::|..::::
plant   842 SQYSFYKSLLICFIQIFFSFISGVSGTSLFNSVSLMAYNVFYTSVPVL-VSVIDKDLSEASVMQH 905

  Fly  1320 PYLYKNGRLGVAYRPHDFWLILLDALYQSLVIFFVALCAYAESDVGIWEFGTTITASCLFANLVH 1384
            |.:....:.|....|..|......:|:.::::|.:.:.|||.....:.|.|....:.|::.....
plant   906 PQILFYCQAGRLLNPSTFAGWFGRSLFHAIIVFVITIHAYAYEKSEMEELGMVALSGCIWLQAFV 970

  Fly  1385 CAIEIRSWTVLHVLSIVLSLGSFYLFAIVYDSVCMNCFGVRSSYWVIFVCFASAVHWLVIMLSTV 1449
            .|.|..|:|||..|||..:|..||....::.::..:     ..|.::|...:...:|:.:.|...
plant   971 VAQETNSFTVLQHLSIWGNLVGFYAINFLFSAIPSS-----GMYTIMFRLCSQPSYWITMFLIVG 1030

  Fly  1450 VAVLPRLLLTTVRISLCPDDSTKVILQSKRERSRGEAL 1487
            ..:.|...|...|.:..|   :|:.:..:.||..|..|
plant  1031 AGMGPIFALKYFRYTYRP---SKINILQQAERMGGPIL 1065

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 24/52 (46%)
ATPase-Plipid 250..1473 CDD:273734 359/1258 (29%)
E1-E2_ATPase 302..>394 CDD:278548 38/92 (41%)
Cation_ATPase <880..965 CDD:289987 31/85 (36%)
HAD_like <1177..1240 CDD:304363 40/63 (63%)
PhoLip_ATPase_C 1223..1468 CDD:292829 66/245 (27%)
ALA2NP_568633.2 PhoLip_ATPase_N 37..100 CDD:292826 22/48 (46%)
ATPase-Plipid 50..1056 CDD:273734 359/1263 (28%)
E1-E2_ATPase 105..>193 CDD:278548 39/90 (43%)
Cation_ATPase 469..565 CDD:289987 44/266 (17%)
HAD_like <762..799 CDD:304363 24/38 (63%)
PhoLip_ATPase_C 810..1049 CDD:292829 66/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.