DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33298 and atp10a

Sequence 1:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster
Sequence 2:XP_021332876.1 Gene:atp10a ZFINID:ZDB-GENE-101102-1 Length:1524 Species:Danio rerio

Alignment Length:1429 Identity:575/1430 (40%)
Similarity:805/1430 (56%) Gaps:260/1430 (18%)


  Fly   171 ARE--PSAPTSATGGRGHSRQASRSESIYTLRRTEAPPWWKRLTLCNYNTGDKFEERSYRTVVPN 233
            |||  .|..|.:...:.|.|:.|:.||             |..|:             :..::.:
Zfish     2 ARETGESGETKSGKVKKHKRRKSKKES-------------KTRTV-------------HANILYD 40

  Fly   234 HTVPPKTPKRDHPNGQFVGNKIRTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWVPEISAFG 298
            |     |...|:||..:..|||:|||||||||:||||.|||||.||:||:||.|||:||.::||.
Zfish    41 H-----TKGGDNPNRHYANNKIKTTKYTLLSFLPKNLFEQFHRFANVYFVFIALLNFVPVVNAFQ 100

  Fly   299 KEVAMIPVLFVLGVTAVKDLFEDRRRRASDKRINNTTCRVYDGETERYKKVKWQELRVGDIVHLS 363
            .|:|:.||:|:|.|||:|||:||.||..|||.||:..|.||....:||.:..|:||||||.:.|.
Zfish   101 PELALAPVVFILSVTAIKDLWEDYRRHRSDKEINHMDCLVYCRSEKRYVEKYWKELRVGDFIRLR 165

  Fly   364 NNETVPADILLLRTSDPQGVCYIDTCDLDGETNLKRREVVRGFEEMQSIFVPSKFVSRVEADAPT 428
            .||.:|||:|||.||||..:|:|:|..||||||||:|:|||.|.::...|.|.|:.|.:|.:.|.
Zfish   166 CNEILPADVLLLSTSDPDRLCHIETATLDGETNLKQRQVVRSFIDLDCEFDPLKYNSVIECEKPN 230

  Fly   429 TKLYRFHGALIHPTGERVPISTECLLLRESRLKNTDYIEGIVVYAGHETKSMLNNSGPRYKRSQV 493
            ..|.||.|.:||.:|.|..:..:.||||...::||:...|||:|||||||:||||:|||||||::
Zfish   231 NDLNRFRGYIIHRSGRRDGLYKDNLLLRGCTIRNTEEAVGIVIYAGHETKAMLNNNGPRYKRSKL 295

  Fly   494 EQQMNIDVIWCVIILLILCVVGAIGCRMWLSSFTH----FPVPYLPPNKLTANMESMWIFWTYIV 554
            |:|||:||.|||||||::|:..|||..:|:..:..    |.|......:|:..:.::::|.|.|:
Zfish   296 ERQMNVDVFWCVIILLVMCLFSAIGHGLWMFQYGDKRPVFDVLGPEGTELSPVVSAIYLFLTMII 360

  Fly   555 ILQVMIPLSLYVTIELCKILQVFHIHNNVDLFDAETNKQTECRAMNITEELGQIQHIFTDKTGTL 619
            :.||:||:||:|:||:.||.||:.||.:::|:|.||:...:|||:||||:|||:|:||:||||||
Zfish   361 VFQVLIPISLFVSIEIVKICQVYFIHQDLELYDEETDSHLQCRALNITEDLGQMQYIFSDKTGTL 425

  Fly   620 TENKMIFRRCVVNGSDYNHPP------------------------------------------SE 642
            |||||:||||.|.|.:|:|..                                          |:
Zfish   426 TENKMVFRRCTVAGVEYSHDANARRIAMYQEVESEEEDCTSHGGTLPRRDSVASHQSGKVVLRSQ 490

  Fly   643 LEKIYSKPGA-------------------------PAPPLIPNDNLNSDMAQLTQGTYLTPHAQR 682
            ..|.:.:.|:                         |.|.|:  |.:|...:|:   .::..|:|.
Zfish   491 STKSHRRTGSRAEAKRASILSKHTAFSSPMEKDITPDPQLM--DKVNECSSQM---EFMRFHSQS 550

  Fly   683 IQ----------EFLVVLAICNTVIVGAAPHRDMMNASGIIEVQQIGNSPANLKHGKQRQKLLAS 737
            :.          :|.:.|.|||||:|                     :|| |....|.|:..|.|
Zfish   551 LNQIPPDLCDVFDFFIALTICNTVVV---------------------SSP-NQPRQKVRRFELKS 593

  Fly   738 STSTT-------TTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQPTL 795
            ...|.       |.:.:.:|..:...         ..||.:||               .||:...
Zfish   594 PVKTIEDFIKRFTPSRLTSGSNSSSS---------SSLATNRS---------------SSHKLGC 634

  Fly   796 SPISS-SAESSPNSESE------------SPSPPMKNKSLSNSISPTGRAKAVINSKITSIATFL 847
            |.:|| |||::....:|            ||.||..:||           ||:...:.       
Zfish   635 SMLSSPSAENTLTKLNEEKRQEHDLQHAFSPVPPNFDKS-----------KALAQDEC------- 681

  Fly   848 NAKTQGKRMKLPSSKTGTIYRTADGRPLYEAESPDELALVNAAYSYDCCLLNRSPNQILVSMPMA 912
                                     ...:|||||||.|||.||.:|.|.|:.|.|:|:.|.:|..
Zfish   682 -------------------------ELRFEAESPDEAALVYAARAYKCALVGRLPDQVTVELPHL 721

  Fly   913 GATREYEILKVLPFDSSRKCMSIVVRQIGSQEIVLYTKGADSSIMPVLVP----CSHNSPEGILR 973
            |.. .:|:|..|.|||:||.||:||:...:::|.:|||||||.||.::.|    |.......|| 
Zfish   722 GKL-SFELLHTLGFDSTRKRMSVVVKHPLTEQITVYTKGADSVIMDLIRPATDDCKGKRQRKIL- 784

  Fly   974 EQTQQLLDRYAREGLRILVMAKRTLNSADYTDWWARHQEIEMSLENRERRLRDSFAKLESNLTLL 1038
            .:||..|:.||.:|||.|.:||:.|:..:|..|..||.|.|.:::.||..|.:|..:||:||.||
Zfish   785 YKTQNYLNLYAADGLRTLCIAKKVLSKEEYASWLQRHLEAETAIQRREELLFESALRLETNLQLL 849

  Fly  1039 GATGIEDRLQDGVPETIASLLSAGISVWVLTGDKPETAINIAYSAKLFTQQMELIRLTARSRDAA 1103
            ||||||||||||||||||||..||:.:|||||||.||||||||:.||...:.|:|.|.|.|::|.
Zfish   850 GATGIEDRLQDGVPETIASLRKAGLQIWVLTGDKQETAINIAYACKLLDPEEEIITLNADSQEAC 914

  Fly  1104 ----ETAINF----YLTDMENDK----------------TTSTLGYGQSLRKKQRALVVDGKTLT 1144
                |.::::    :|.|.....                :.::.|:.......:..||:||:||.
Zfish   915 ARLLENSLHYIQAKFLCDPRAGPQAAGDYAGIHFSSPVCSPTSSGHSGPFLVHRLGLVIDGRTLA 979

  Fly  1145 FILDPKSKLILPFLRLSKRCASVLCCRSTPLQKAYLVKVVKEELNLRTLAIGDGANDVSMIQMAD 1209
            :.||  ..|...||.:::.|.||||||||||||:.:||:|:.:|.:.|||||||||||||||:||
Zfish   980 YALD--KSLEDKFLAVARSCRSVLCCRSTPLQKSMVVKLVRNKLKVMTLAIGDGANDVSMIQVAD 1042

  Fly  1210 VGVGISGQEGMQAVMAADFTLPRFRYLERLLLAHGYWCYDRLSRMILYFFYKNAAFVFLIFWYQL 1274
            ||||||||||||||||:||.|||||||::|||.||:|||.||:.||||||||||.||.||||||.
Zfish  1043 VGVGISGQEGMQAVMASDFALPRFRYLQKLLLVHGHWCYSRLANMILYFFYKNAMFVALIFWYQF 1107

  Fly  1275 YCGFSGQVMMDQMYLMLYNLIFTSLPPLAIGVYDKRVAEDLLLKNPYLYKNGRLGVAYRPHDFWL 1339
            ||||||..|:||.||:.:||:|::.|.|..|..||.|:.:.|.:.|.||.||:....|:|:.||:
Zfish  1108 YCGFSGSAMVDQWYLIFFNLMFSAFPQLITGTLDKDVSAETLQELPQLYMNGQNSEEYKPYMFWM 1172

  Fly  1340 ILLDALYQSLVIFFVALCAYAESDVGIWEFGTTITASCLFANLVHCAIEIRSWTVLHVLSIVLSL 1404
            .::||.||||:.||:...||.:|||.::.:||.||...||..|:|..||.::||.::.:||..|:
Zfish  1173 NMIDAFYQSLICFFIPYFAYIDSDVDLFTWGTPITTLALFTILLHLGIETKTWTWMNWVSIGFSM 1237

  Fly  1405 GSFYLFAIVYDSVCMNCFGVRSSYWVIFVCFASAVHWLVIMLSTVVAVLPRLLLTTVRISLCPD 1468
            ..|:..|:.|::.|..||...::||.:.......:.:|:.:::.|.|:|||......:.:|.|:
Zfish  1238 ALFFTVALCYNASCPTCFSPSNTYWTMQRLLGDPLFYLLCVVTPVAALLPRYCYRACQGTLFPN 1301

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 34/50 (68%)
ATPase-Plipid 250..1473 CDD:273734 558/1349 (41%)
E1-E2_ATPase 302..>394 CDD:278548 51/92 (55%)
Cation_ATPase <880..965 CDD:289987 42/89 (47%)
HAD_like <1177..1240 CDD:304363 48/63 (76%)
PhoLip_ATPase_C 1223..1468 CDD:292829 114/245 (47%)
atp10aXP_021332876.1 P-type_ATPase_APLT_Dnf-like 54..1188 CDD:319770 522/1232 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 1005 1.000 Inparanoid score I269
OMA 1 1.010
OrthoDB 1 1.010 D37083at33208
OrthoFinder 1 1.000 FOG0000836
OrthoInspector 1 1.000 T596839
orthoMCL 1 0.900 OOG5_128792
Panther 1 1.100 O PTHR24092
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3512
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.