DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33298 and atp10b

Sequence 1:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster
Sequence 2:XP_017214606.1 Gene:atp10b ZFINID:ZDB-GENE-130530-796 Length:1294 Species:Danio rerio

Alignment Length:1356 Identity:534/1357 (39%)
Similarity:767/1357 (57%) Gaps:203/1357 (15%)


  Fly   207 WWKRLTLCNYN-TGDKFEERSYRTVVPNHTVP-PKTPKRDHPNGQFVGNKIRTTKYTLLSFIPKN 269
            |...|||.... |..:.::|..|.||.|  :| ....||:.||.|:.||.|:|.||.|.||:|.|
Zfish     3 WTSPLTLFQRGWTRHRDQDRPIRKVVSN--LPFEDLRKREQPNRQYEGNAIKTNKYRLWSFLPMN 65

  Fly   270 LLEQFHRVANLYFIFIVLLNWVPEISAFGKEVAMIPVLFVLGVTAVKDLFEDRRRRASDKRINNT 334
            |.|||||:||:||:.:.:||::|.::||..|||:||:..:|.:|||||.:||.||..:|:::||.
Zfish    66 LFEQFHRLANIYFVGLAILNFIPVVNAFQPEVALIPICIILALTAVKDGWEDFRRYQTDQQLNNM 130

  Fly   335 TCRVYDGETERYKKVKWQELRVGDIVHLSNNETVPADILLLRTSDPQGVCYIDTCDLDGETNLKR 399
            .|.::......:.:.:|:::||||.|.:.:||.:|||||||.||||.|||:::|.:||||||||:
Zfish   131 PCFIFRRRLMCFVERRWKDVRVGDFVKVLSNEIIPADILLLHTSDPNGVCHMETANLDGETNLKQ 195

  Fly   400 REVVRGFEEMQSIFVPSKFVSRVEADAPTTKLYRFHGALIHPTGERVPISTECLLLRESRLKNTD 464
            |:||.||..:...|.|..|.|.|..:.|...|..|.|.:..|...|.....:.||||...::|||
Zfish   196 RKVVPGFSTLGEPFQPQTFDSTVVCENPNNNLNLFKGFIERPDKRRSGFGIDSLLLRGCTVRNTD 260

  Fly   465 YIEGIVVYAGHETKSMLNNSGPRYKRSQVEQQMNIDVIWCVIILLILCVVGAIGCRMWLSSFTHF 529
            ...||||||||||||||||:|||||||::|::||.||::||::|..:|::||:|..:||.:|:..
Zfish   261 DAAGIVVYAGHETKSMLNNNGPRYKRSKIERKMNTDVLFCVLLLFFMCLIGALGHAIWLETFSTM 325

  Fly   530 PVPYLPP----NKLTANMESMWIFWTYIVILQVMIPLSLYVTIELCKILQVFHIHNNVDLFDAET 590
            | .|:.|    |.:::.:...::|:|.|::||||||:||||:|||.|:.|:|.|..:.:|:|.|.
Zfish   326 P-SYIVPDSNGNYISSALAGFYMFFTMIILLQVMIPVSLYVSIELVKMGQIFFITQDAELYDQEL 389

  Fly   591 NKQTECRAMNITEELGQIQHIFTDKTGTLTENKMIFRRCVVNGSDYNHPPS-------------- 641
            :.:.:|||:||||:|||||::|:|||||||||||:|:||.:.|::|.|..:              
Zfish   390 DSRVQCRALNITEDLGQIQYVFSDKTGTLTENKMVFKRCTIMGTEYCHEENAARLAVINGGGNEE 454

  Fly   642 ELEKIYSKPGAPAPPLIPNDNLNSD---------------------------------------- 666
            |...||.|  ...|||.|.:.|..|                                        
Zfish   455 EEVTIYQK--TKLPPLFPLEELQDDHTGHKNHANTQVAAASRRRSKVAAGAQSDMAFSSPLETVV 517

  Fly   667 -------------MAQLTQGTYLTPHAQRIQEFLVVLAICNTVIVGAAPHRDMMNASGIIEVQQI 718
                         ||.:..|.||        :|.:.|||||||:|.... .......|.......
Zfish   518 VPDRKLMLEVDHQMASIQTGPYL--------DFFLALAICNTVVVSTLT-AQRQRVKGRRNSSYS 573

  Fly   719 GNSPANLKHG---KQRQKLLASSTSTTTTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPSPPP 780
            |:|..|:...   ...||..:|                            :|...:|.....|  
Zfish   574 GSSSHNMGQWFKISSLQKFFSS----------------------------MRFKRNRETMADP-- 608

  Fly   781 NLLFALPAQSHQPTLSPISSSAESSPNSESESPSPPMKNKSLSNSISPTGRAKAVINSKITSIAT 845
               ||:  ...:|....|||.::|.|..:                         ||:|       
Zfish   609 ---FAI--DEDEPDTFHISSVSDSRPGQK-------------------------VISS------- 636

  Fly   846 FLNAKTQGKRMKLPSSKTGTIYRTADGRPL-------YEAESPDELALVNAAYSYDCCLLNRSPN 903
                  :||                |.|.|       |||.||||.||::||.:|...::.|:|.
Zfish   637 ------EGK----------------DKRSLSRSEEVCYEAHSPDEAALIHAAKAYGFTMVERTPR 679

  Fly   904 QILVSMPMAGATREYEILKVLPFDSSRKCMSIVVRQIGSQEIVLYTKGADSSIMPVLVPC-SHNS 967
            .:.|.:|.. ...::|:|.||.|||:|:.|||:||...:.||::|||||||::|..|... |..|
Zfish   680 YVTVKLPNE-TLLKFEVLDVLTFDSTRRRMSIIVRHPHTNEIIMYTKGADSAVMEKLGNVFSVES 743

  Fly   968 PEGILREQTQQLLDRYAREGLRILVMAKRTLNSADYTDWWARHQEIEMSLENRERRLRDSFAKLE 1032
            ....:..:||:.||.|||:|||.|..||:.::..::..|:...||...:::.:|.||.::...:|
Zfish   744 AAKRIAVRTQKDLDMYARDGLRTLCFAKKVISEQEFKAWFTSRQEALSAIDEKEERLMETANDIE 808

  Fly  1033 SNLTLLGATGIEDRLQDGVPETIASLLSAGISVWVLTGDKPETAINIAYSAKLFTQQMELIRLTA 1097
            :|||||||||||||||:.|||||.:|..||:.||||||||||||:|||||.||...:..:...|.
Zfish   809 NNLTLLGATGIEDRLQENVPETIQALRRAGMQVWVLTGDKPETAVNIAYSCKLLDHEDLVFTFTT 873

  Fly  1098 RSRDAAETAINFYLTDMENDKTTSTLGYGQSLR-----------KKQRALVVDGKTLTFILDPKS 1151
            ..:...:..:...|:::.  :|...||.....|           :....||:||.||...|  ..
Zfish   874 NKKSVCKMRLEDTLSEVR--RTWGGLGLDPQFRGYNSTFTGPLMEPSIGLVIDGPTLNMAL--SE 934

  Fly  1152 KLILPFLRLSKRCASVLCCRSTPLQKAYLVKVVKEELNLRTLAIGDGANDVSMIQMADVGVGISG 1216
            .|:..|:.|.|.|.:|||||.|||||:.:|||::::|.:.|||:|||||||:|||.||||:|:||
Zfish   935 DLVEQFVELCKHCRAVLCCRVTPLQKSSVVKVIRQKLRVMTLAVGDGANDVNMIQAADVGIGVSG 999

  Fly  1217 QEGMQAVMAADFTLPRFRYLERLLLAHGYWCYDRLSRMILYFFYKNAAFVFLIFWYQLYCGFSGQ 1281
            |||||||||:||.:.||::|:||||.||:|||.||:.|::||||||.|:|.|:||||.:|||||.
Zfish  1000 QEGMQAVMASDFAITRFKHLQRLLLVHGHWCYSRLANMVIYFFYKNVAYVNLLFWYQFFCGFSGT 1064

  Fly  1282 VMMDQMYLMLYNLIFTSLPPLAIGVYDKRVAEDLLLKNPYLYKNGRLGVAYRPHDFWLILLDALY 1346
            .|:|...::.:||.|||.||:..|:.||.|::..||..|.||:.|:....||...||:.:|||.|
Zfish  1065 AMIDYWLMIFFNLFFTSAPPIMFGIMDKEVSDSTLLSLPELYRRGQHSEGYRRSTFWIAILDAFY 1129

  Fly  1347 QSLVIFFVALCAYAESDVGIWEFGTTITASCLFANLVHCAIEIRSWTVLHVLSIVLSLGSFYLFA 1411
            ||||.||:....|.:||:||:.|||.:....||..::|.||||:||||:|.:.:|.|:..:::..
Zfish  1130 QSLVCFFIPYWTYNDSDIGIFSFGTPMNTVSLFTIILHLAIEIKSWTVVHWVIMVGSVLVYFILT 1194

  Fly  1412 IVYDSVCMNCFGVRSSYWVIFVCFASAVHWLVIMLSTVVAVLPRLLLTTVRISLCP 1467
            :.|.::|::|......||::....|..:.:||.:|:||||:|||..|..::.:|.|
Zfish  1195 LAYSAICISCNPPSDPYWIMHKQMADPMFYLVCVLTTVVALLPRYTLRVLKGTLAP 1250

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 27/50 (54%)
ATPase-Plipid 250..1473 CDD:273734 518/1312 (39%)
E1-E2_ATPase 302..>394 CDD:278548 43/92 (47%)
Cation_ATPase <880..965 CDD:289987 38/86 (44%)
HAD_like <1177..1240 CDD:304363 41/63 (65%)
PhoLip_ATPase_C 1223..1468 CDD:292829 112/246 (46%)
atp10bXP_017214606.1 PhoLip_ATPase_N 38..95 CDD:292826 31/57 (54%)
ATPase-Plipid 46..1258 CDD:273734 518/1312 (39%)
Cation_ATPase <656..738 CDD:289987 37/83 (45%)
R3H 793..856 CDD:294210 41/63 (65%)
HAD_like <960..1006 CDD:304363 31/46 (67%)
PhoLip_ATPase_C 1006..1251 CDD:292829 112/246 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D37083at33208
OrthoFinder 1 1.000 FOG0000836
OrthoInspector 1 1.000 T596839
orthoMCL 1 0.900 OOG5_128792
Panther 1 1.100 O PTHR24092
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3512
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.810

Return to query results.
Submit another query.