DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33298 and atp10d

Sequence 1:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster
Sequence 2:XP_012818017.1 Gene:atp10d XenbaseID:XB-GENE-1000388 Length:1373 Species:Xenopus tropicalis

Alignment Length:1374 Identity:529/1375 (38%)
Similarity:797/1375 (58%) Gaps:169/1375 (12%)


  Fly   209 KRLTLCNYNTGDKFEERSYRTVVPNHTVPPKTPKRDHPNGQF-----------VGNKIRTTKYTL 262
            ::|...|.:.|.......:|.|:|             ..|||           ..|:|:||||||
 Frog    32 RKLLGFNKSNGTSSNSTKHRVVIP-------------CLGQFKEEYEKLTKAYKNNRIQTTKYTL 83

  Fly   263 LSFIPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKEVAMIPVLFVLGVTAVKDLFEDRRRRAS 327
            |:|||:||.|||||.|||||:|:|.|||||.:.||.||:.|:|::.||.:.|:||..||.|:...
 Frog    84 LNFIPRNLFEQFHRAANLYFLFLVFLNWVPLVEAFQKEITMLPLVAVLTIIAIKDGLEDYRKYKL 148

  Fly   328 DKRINNTTCRVYDGETERYKKVKWQELRVGDIVHLSNNETVPADILLLRTSDPQGVCYIDTCDLD 392
            ||.|||...:||..:.::||:..|:::.||..:.|..:|.:|||::||.:|||.|:|:|:|..||
 Frog   149 DKVINNIVTQVYCRKEKKYKESCWKDVNVGHFIRLQCDEIIPADMVLLHSSDPDGICHIETSSLD 213

  Fly   393 GETNLKRREVVRGFEEMQSIFVPSKFVSRVEADAPTTKLYRFHGALIHPTGERVPISTECLLLRE 457
            ||||||:|:||:|: .|...|.|.||..|::.:.||:.:..|.|.|.||..|::.:|.:.||||.
 Frog   214 GETNLKQRQVVKGY-SMDDEFDPEKFSGRIQCENPTSDISSFKGFLDHPNKEKIGLSKQNLLLRG 277

  Fly   458 SRLKNTDYIEGIVVYAGHETKSMLNNSGPRYKRSQVEQQMNIDVIWCVIILLILCVVGAIGCRMW 522
            ..::||:.:.|||||||||||:||||||||||||::|:::|.|::|.|::|:.:|:.||||..:|
 Frog   278 CIVRNTEAVVGIVVYAGHETKAMLNNSGPRYKRSRLERRLNTDILWSVLLLIAMCLFGAIGHGLW 342

  Fly   523 LSSFTHFPVPYLPP---NKLTANMESMWIFWTYIVILQVMIPLSLYVTIELCKILQVFHIHNNVD 584
            |:.|...|:..:|.   ...:..:...::|||.|::|||:||:||||:||:.|:.|::.|.|:.:
 Frog   343 LAGFPESPIFSIPEPGGQHTSPALAGFYMFWTMIILLQVLIPISLYVSIEIVKLGQIYFIQNDSE 407

  Fly   585 LFDAETNKQTECRAMNITEELGQIQHIFTDKTGTLTENKMIFRRCVVNGSDYNHPPS-------- 641
            .:..:::...||||:||.|:|||:|:||:|||||||||||:||||.:.|.:|:|..:        
 Frog   408 FYCEKSDSMIECRALNIAEDLGQVQYIFSDKTGTLTENKMVFRRCSIAGMEYSHEANARRLESYQ 472

  Fly   642 ------------------------ELEKIYS------------KPGAPAPP-------------- 656
                                    |..|..|            ..||..||              
 Frog   473 ESDMHGSNLCHVTCISQSSVCKSKEQRKAASNKSLNNFAQGEDNDGASHPPNPRHVAFSSPMEKD 537

  Fly   657 LIPNDNLNSDMAQLT-QGTYLTPHAQ-------RIQEFLVVLAICNTVIVGAAPHRDMMNASGII 713
            ::|:..|.|...|:. :..|::..|:       .|.:|.:.|||||||:|               
 Frog   538 VVPDPRLLSKFDQINPKSLYMSEEAEDTALETSYIVDFFLALAICNTVVV--------------- 587

  Fly   714 EVQQIGNSPANLKHGKQRQKLLASSTSTTTTTTIINGPTTQPQVVSIPADRY-IRLAESRSVTPS 777
               .:.|.|        |||:...|        ::..|....:.:.....|: :|...:.|.|..
 Frog   588 ---SLPNQP--------RQKVRMPS--------MVRTPMKSLEEIKQMFQRFSVRKLSASSFTSG 633

  Fly   778 PPPNLLFALPAQSHQPTLSPISSSAESSPNSESESPSPPMKNKSLSNSISPTG--RAKAVINSKI 840
            ..      .|:::.    |...|........:..||:..:.:||: |.:...|  .:.|.:..::
 Frog   634 KD------CPSENG----SNFGSKLSFFTRGKLASPTAELADKSI-NDLQAAGSLNSTAELEPEV 687

  Fly   841 TSIATFLNAKTQGKRMKLPSSKTGTIYRTADGRPLYEAESPDELALVNAAYSYDCCLLNRSPNQI 905
            ...:.|:.|..:             :.:.|.....||||||||.|||:||.:|:|.|.:|:|:|:
 Frog   688 LEQSNFVTACDE-------------LDKAAACELCYEAESPDEAALVHAARAYNCTLQSRTPDQV 739

  Fly   906 LVSMPMAGATREYEILKVLPFDSSRKCMSIVVRQIGSQEIVLYTKGADSSIMPVLVPCSHNSPEG 970
            .|.:...|.. .:::|.:|||||.||.||:::|...:.::|:|||||||:||.::...|.::...
 Frog   740 TVELGFIGPL-TFQVLHILPFDSVRKRMSVIIRHPLTNKVVVYTKGADSAIMDLIAMTSEDNKAA 803

  Fly   971 ILREQ----TQQLLDRYAREGLRILVMAKRTLNSADYTDWWARHQEIEMSLENRERRLRDSFAKL 1031
            ::::.    ||:.||.||:.|||.|.:||:.:..::|.:|...|...|.|::|||..|.:|..:|
 Frog   804 MVKKNIQMLTQKHLDDYAKGGLRTLCIAKKVMTDSEYAEWLQSHFLAETSIDNREEMLYESAVRL 868

  Fly  1032 ESNLTLLGATGIEDRLQDGVPETIASLLSAGISVWVLTGDKPETAINIAYSAKLFTQQMELIRLT 1096
            |:.||||||||||||||:|||:||.||..|||::|:|||||.|||:||||:.:|.....:|..|:
 Frog   869 ETKLTLLGATGIEDRLQEGVPDTIESLRKAGINIWMLTGDKEETAVNIAYACRLLEHSDKLFNLS 933

  Fly  1097 ARSRDAAETAINFYLTDMENDKTTSTLGYGQSLRKKQR-ALVVDGKTLTFILDPKSKLILPFLRL 1160
            ...:::.||.:|..:.::::....:....||..:.... .||:||.||...:  ...|...||:|
 Frog   934 KHEKESCETLMNIMIDEIDSLGKPNAFSSGQQDKSGLHFGLVIDGGTLEIAM--HESLQSKFLQL 996

  Fly  1161 SKRCASVLCCRSTPLQKAYLVKVVKEELNLRTLAIGDGANDVSMIQMADVGVGISGQEGMQAVMA 1225
            ::||.:|:|||:|||||:.:||:|:..|.:..||||||||||||||:||:||||||||||||||:
 Frog   997 TERCRAVICCRATPLQKSKVVKLVRNNLQVMALAIGDGANDVSMIQVADIGVGISGQEGMQAVMS 1061

  Fly  1226 ADFTLPRFRYLERLLLAHGYWCYDRLSRMILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMYLM 1290
            :||.:..|::|.:|||.||:|||.||:.|||||||||..||.|:||||.:|||||..|.|...|:
 Frog  1062 SDFAVSHFKHLRKLLLVHGHWCYTRLANMILYFFYKNLMFVNLLFWYQFFCGFSGTAMTDFWMLI 1126

  Fly  1291 LYNLIFTSLPPLAIGVYDKRVAEDLLLKNPYLYKNGRLGVAYRPHDFWLILLDALYQSLVIFFVA 1355
            |:||:|||:||:..|:.||.|:.:.|...|.|||:|:...|||...||:.:|||.||||..||:.
 Frog  1127 LFNLLFTSVPPIIYGILDKDVSAETLTALPELYKSGQTSQAYRSSTFWVTILDAFYQSLACFFIP 1191

  Fly  1356 LCAYAESDVGIWEFGTTITASCLFANLVHCAIEIRSWTVLHVLSIVLSLGSFYLFAIVYDSVCMN 1420
            ..||..||:||:.||..:..|.||..|:|..||.:|.|.:|.:.:..|:.:::.|::.:.:||:|
 Frog  1192 YFAYIGSDLGIYSFGNFLITSALFVVLLHLLIESKSLTWIHWIVMGASIAAYFAFSLAFGAVCIN 1256

  Fly  1421 CFGVRSSYWVIFVCFASAVHWLVIMLSTVVAVLPRLLLTTVRISLCPDD---STKVILQSKRERS 1482
            |....:.||::.........:||.:||..:|:|||.:....:.::.|..   :.|:.:.|..|||
 Frog  1257 CNPPANPYWIVQNHVRDPAFYLVCLLSIFIALLPRYVCRIFQGTVFPTPQLLAKKLDVMSPEERS 1321

  Fly  1483 RGEALLVTW 1491
            |.   |..|
 Frog  1322 RA---LKRW 1327

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 35/61 (57%)
ATPase-Plipid 250..1473 CDD:273734 514/1314 (39%)
E1-E2_ATPase 302..>394 CDD:278548 39/92 (42%)
Cation_ATPase <880..965 CDD:289987 39/85 (46%)
HAD_like <1177..1240 CDD:304363 40/63 (63%)
PhoLip_ATPase_C 1223..1468 CDD:292829 107/245 (44%)
atp10dXP_012818017.1 ATPase-Plipid 71..1304 CDD:273734 512/1295 (40%)
PhoLip_ATPase_N <71..122 CDD:292826 35/51 (69%)
Cation_ATPase <714..791 CDD:289987 38/78 (49%)
HAD_like <1029..1076 CDD:304363 35/47 (74%)
PhoLip_ATPase_C 1059..1304 CDD:292829 107/245 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D37083at33208
OrthoFinder 1 1.000 FOG0000836
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.790

Return to query results.
Submit another query.