DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33298 and Atp10d

Sequence 1:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster
Sequence 2:XP_008768400.1 Gene:Atp10d RGDID:1588541 Length:1412 Species:Rattus norvegicus

Alignment Length:1454 Identity:569/1455 (39%)
Similarity:810/1455 (56%) Gaps:238/1455 (16%)


  Fly   202 TEAPPW----WKRLTLCNYNT-GDKFEERSYR--TVVPNHTVPPKTPK----------------- 242
            ||...|    |.|  |.|..| ||  :||||.  :::......|:||:                 
  Rat     2 TELLRWARHHWHR--LMNGRTQGD--DERSYNYSSLLACGGKSPQTPRPAGKHRVVIPHLQGFKD 62

  Fly   243 -RDHPNGQFVGNKIRTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKEVAMIPV 306
             .:..:|.:|.|:|||||||||:|:|:||.|||||.|||||:|:|:|||||.:.||.||:.|:|:
  Rat    63 EYERFSGTYVNNRIRTTKYTLLNFVPRNLFEQFHRAANLYFLFLVVLNWVPLVEAFQKEITMLPL 127

  Fly   307 LFVLGVTAVKDLFEDRRRRASDKRINNTTCRVYDGETERYKKVKWQELRVGDIVHLSNNETVPAD 371
            :.||.:.|:||..||.|:...||:|||...:||..:.::|....|:.:.|||.:.||.||.:|||
  Rat   128 VVVLTIIAIKDGLEDYRKYKIDKQINNLITKVYSRKEKKYIDCCWKNVTVGDFIRLSCNEIIPAD 192

  Fly   372 ILLLRTSDPQGVCYIDTCDLDGETNLKRREVVRGFEEMQSIFVPSKFVSRVEADAPTTKLYRFHG 436
            ::||.::||.|:|:|:|..||||:|||:|:||||:.|..|...|.||.||:|.::|...|.||.|
  Rat   193 MVLLFSTDPDGICHIETSGLDGESNLKQRQVVRGYAEQDSEVDPEKFSSRIECESPNNDLSRFRG 257

  Fly   437 ALIHPTGERVPISTECLLLRESRLKNTDYIEGIVVYAGHETKSMLNNSGPRYKRSQVEQQMNIDV 501
            .|.|...|||.:|.|.||||...::||:.:.|||||||||||:||||||||||||:         
  Rat   258 FLEHSNKERVGLSKENLLLRGCTIRNTEAVVGIVVYAGHETKAMLNNSGPRYKRSK--------- 313

  Fly   502 IWCVIILLI--------LCVVGAIGCRMWLSSFTH---FPVPYLPPNKLTANMESMWIFWTYIVI 555
               .::|.:        :||:.. |..:|||.:.:   |.:|......|:..:...::|||.|::
  Rat   314 ---GVVLYLHALPHPFGVCVLFK-GHGIWLSRYENMLFFNIPEPDGRVLSPVLTGFYVFWTMIIL 374

  Fly   556 LQVMIPLSLYVTIELCKILQVFHIHNNVDLFDAETNKQTECRAMNITEELGQIQHIFTDKTGTLT 620
            |||:||:||||:||:.|:.|::.|.::|:.::.:.:...:|||:||||:|||||::|:|||||||
  Rat   375 LQVLIPISLYVSIEIVKLGQIYFIQSDVEFYNEKMDSTIQCRALNITEDLGQIQYLFSDKTGTLT 439

  Fly   621 ENKMIFRRCVVNGSDYNH----------------------------------------------- 638
            ||||:||||.|.|.||.|                                               
  Rat   440 ENKMVFRRCSVAGFDYCHEENAKRLESYQEAVSEEEECTDTLSGSLSLGSVARPRAQSCRTAHSR 504

  Fly   639 ----PPSEL--------------EKIYSKPGAPAPPL----IPNDNLNSDMAQLTQG--TYLTPH 679
                |.::|              |.::|:..|.:.|:    :|:..|....:|:|..  |.|...
  Rat   505 LPGKPLAQLSGSTSAVGNGEGSGEVLHSRQAAFSSPIETDVVPDTRLLDKFSQITPQLFTRLDGA 569

  Fly   680 AQR-------IQEFLVVLAICNTVIVGAAPHRDMMNASGIIEVQQIGNSPANLKHGKQRQKLLAS 737
            ||.       |.:|.:.|||||||:|.|.                  |.|        |||:..|
  Rat   570 AQSAPLETLYIMDFFIALAICNTVVVSAP------------------NQP--------RQKIGLS 608

  Fly   738 STSTTTTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQPT--LSPIS- 799
            |.......::               :....:.:..||..|..|:|.....:.|..|.  :|.|| 
  Rat   609 SLGGMPIKSL---------------EEIKNIFQKLSVRRSSSPSLASGKDSTSGTPCAFVSRISF 658

  Fly   800 -SSAESSPNSESESPSPPMKNKSLSNSISPTGRAKAVINSKITSIATFLNAKTQGKRMKLPSSKT 863
             |..:.||..|.|| |...:....|||                  |....::.:...:.||....
  Rat   659 FSRTKLSPPVEDES-SQMDEIPQASNS------------------ACCTESEAENSDVGLPIDSA 704

  Fly   864 GTIYRTADGRP------LYEAESPDELALVNAAYSYDCCLLNRSPNQILVSMPMAGATREYEILK 922
            ..:    ||.|      .||||||||.|||.||.:|.|.|.:|:|.|::|.....|.. .:::|.
  Rat   705 EAL----DGPPPLASNLCYEAESPDEAALVYAARAYHCTLRSRTPEQVVVDFAALGPL-TFQLLH 764

  Fly   923 VLPFDSSRKCMSIVVRQIGSQEIVLYTKGADSSIMPVLVPCSHN-----SPEGILREQTQQLLDR 982
            :|||||.||.||:|||...|:::|:|||||||.||.:|...|.:     ..:.::||:||:.||.
  Rat   765 ILPFDSVRKRMSVVVRHPLSKQVVVYTKGADSVIMELLSVASSDGTNLEDQQMVIRERTQRHLDE 829

  Fly   983 YAREGLRILVMAKRTLNSADYTDWWARHQEIEMSLENRERRLRDSFAKLESNLTLLGATGIEDRL 1047
            ||:.|||.|.:||:.::..:|.:|...|...|.|::|||..|.:|..:||:.|||||||||||||
  Rat   830 YAKRGLRTLCVAKKVMSDTEYAEWLRNHFLAETSIDNREELLVESAMRLENKLTLLGATGIEDRL 894

  Fly  1048 QDGVPETIASLLSAGISVWVLTGDKPETAINIAYSAKLFTQQMELIRLTARSRDAAETAINFYLT 1112
            |:||||:|.:|..|||.:|:|||||.|||:||||:.||.....:|..|..:|.||....::..|.
  Rat   895 QEGVPESIEALHKAGIKIWMLTGDKQETAVNIAYACKLLEPDDKLFILNTQSEDACGMLMSAILE 959

  Fly  1113 DMENDKTTSTLGYGQSLRKK-----------QRALVVDGKTLTFILDPKSKLILPFLRLSKRCAS 1166
            :::  |.|.......|.||.           :..||:.||||.|.|  :..|...||.|:..|.:
  Rat   960 ELQ--KRTQVSPELASPRKNFPQPPDPQVPGRAGLVITGKTLEFAL--QESLQKQFLELTAWCQA 1020

  Fly  1167 VLCCRSTPLQKAYLVKVVKEELNLRTLAIGDGANDVSMIQMADVGVGISGQEGMQAVMAADFTLP 1231
            |:|||:|||||:.:||:|:..|::.|||||||||||||||:||:|:|:|||||||||||:||.:.
  Rat  1021 VICCRATPLQKSEVVKLVRNHLHVMTLAIGDGANDVSMIQVADIGIGVSGQEGMQAVMASDFAIS 1085

  Fly  1232 RFRYLERLLLAHGYWCYDRLSRMILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMYLMLYNLIF 1296
            :||:|.:|||.||:|||.|||.|||||||||.|:|.|:||||.:|||||..|.|...|:.:||:|
  Rat  1086 QFRHLSKLLLVHGHWCYTRLSNMILYFFYKNVAYVNLLFWYQFFCGFSGTSMTDYWVLIFFNLLF 1150

  Fly  1297 TSLPPLAIGVYDKRVAEDLLLKNPYLYKNGRLGVAYRPHDFWLILLDALYQSLVIFFVALCAYAE 1361
            ||:||:..||.:|.|:.:.||:.|.||::|:....|.|..||:.||||.|||||.|||....|..
  Rat  1151 TSVPPIIYGVLEKDVSAETLLQLPELYQSGQRSEEYLPLTFWITLLDAFYQSLVCFFVPYFTYQG 1215

  Fly  1362 SDVGIWEFGTTITASCLFANLVHCAIEIRSWTVLHVLSIVLSLGSFYLFAIVYDSVCMNCFGVRS 1426
            ||:.|:.||..:..:.|...|:|..||.:|.|.:|:|.||.|:.|::.||:.:.::|:.|....:
  Rat  1216 SDIDIFTFGNPLNTAALLIILLHLVIESKSLTWIHMLVIVGSILSYFFFALAFGALCVTCNPPSN 1280

  Fly  1427 SYWVIFVCFASAVHWLVIMLSTVVAVLPRLLLTTVRISLCPDDSTKVILQSK-----RERSRGEA 1486
            .|.::.......|.:||.:|:|.||:|||.:...::.|:.|..    ||::|     ....|.||
  Rat  1281 PYGIMQKHMLDPVFYLVCVLTTCVALLPRFVYRVLQGSVFPSP----ILRAKYFDRLSPEERAEA 1341

  Fly  1487 LLVTWSRSTSASSIYRITDYGSKN 1510
             |..|..:...:.:  .:.|.|::
  Rat  1342 -LKRWRGTAKVNHV--ASKYASQS 1362

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 34/50 (68%)
ATPase-Plipid 250..1473 CDD:273734 541/1338 (40%)
E1-E2_ATPase 302..>394 CDD:278548 40/92 (43%)
Cation_ATPase <880..965 CDD:289987 43/85 (51%)
HAD_like <1177..1240 CDD:304363 41/63 (65%)
PhoLip_ATPase_C 1223..1468 CDD:292829 112/245 (46%)
Atp10dXP_008768400.1 ATPase-Plipid 71..1322 CDD:273734 541/1333 (41%)
PhoLip_ATPase_N <71..122 CDD:292826 36/51 (71%)
E1-E2_ATPase 128..>216 CDD:278548 39/88 (44%)
Cation_ATPase <723..803 CDD:289987 42/81 (52%)
HAD_like <1046..1077 CDD:304363 27/31 (87%)
PhoLip_ATPase_C 1077..1322 CDD:292829 112/245 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H68636
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D37083at33208
OrthoFinder 1 1.000 FOG0000836
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128792
Panther 1 1.100 LDO PTHR24092
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
87.880

Return to query results.
Submit another query.