DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33298 and CG31729

Sequence 1:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_609634.1 Gene:CG31729 FlyBaseID:FBgn0051729 Length:1256 Species:Drosophila melanogaster

Alignment Length:1511 Identity:418/1512 (28%)
Similarity:650/1512 (43%) Gaps:356/1512 (24%)


  Fly    35 IPNASASSATTSLMMTTSTGLGGVAMGAGEPERTYVFPGGNPVVGSAPGGGGQGIPGVAMAAPSR 99
            :|:...::........:|.|..||..|||               .||.||||..: |....:.|.
  Fly    29 VPSGKQNNNNIRGRRKSSMGYSGVDAGAG---------------SSAAGGGGSFL-GNLFGSNSF 77

  Fly   100 GHARSISHGGGAIVGANGRPIKSA--MKGHQRAFSQ-GQITDSPPG--SAAPAGRGHSRVGSKTD 159
            |.|      .|.|...|.|..:.|  ..|...:.|: .|:|.:..|  .|...|.|....||.|.
  Fly    78 GSA------AGQIRYRNERSRERAKHSNGSYSSISKLAQLTHTSSGVAGAGSIGGGGGGSGSATG 136

  Fly   160 FILPPGHKEEPAREPSAPT-------------------SATGGRGHSRQASRSESIYTLRRTEAP 205
            ..:..|.....|...||.|                   |:|....|:|:.|:|.||..:      
  Fly   137 IKVTTGDGSVAASGGSAATGDLSNGATHSTTVIDPENGSSTVFYQHNRRKSKSRSIGNV------ 195

  Fly   206 PWWKRLTLCN-YNTGDKFEERSYRTV----VPNHTVPPKTPKRDHPNGQFVGNKIRTTKYTLLSF 265
               .:|.||: :....:..|...|||    |.....||              |:||..||..::|
  Fly   196 ---CKLCLCSCWRKWFRPRELRARTVNLGRVNTEKFPP--------------NEIRNQKYNFITF 243

  Fly   266 IPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKEVAMIPVLFVLGVTAVKDLFEDRRRRASDKR 330
            :|..|.|||....||||:.:.|..::|:|..........|:.|||.||..::..:|.||...|..
  Fly   244 LPLVLFEQFRFFLNLYFLLMALSQFIPDIRIGYPYTYWGPLGFVLMVTICREAVDDLRRHQRDHE 308

  Fly   331 INNTTC-RVYDGETERYKKVKWQELRVGDIVHLSNNETVPADILLLRTSDPQGVCYIDTCDLDGE 394
            :|:... |:.......|:.|...:|:|||::.:..||.||||::||||||..|..::.|..||||
  Fly   309 VNSQKYKRLSSTNISGYEMVPSSKLKVGDVIIVEKNERVPADLILLRTSDRSGSVFVRTDQLDGE 373

  Fly   395 TNLKRREVVRGFE------EMQSIFVPSKFVSRVEADAPTTKLYRFHGALIHPTG-ERVPISTEC 452
            |:.|.|..|...:      |:.||.. |.:|.:     |...::.|........| |...:|.|.
  Fly   374 TDWKPRLAVPYTQKLSRDSELHSIDA-SFYVEK-----PQNDIHSFIATFCMADGSEDTGLSVEN 432

  Fly   453 LLLRESRLKNTDYIEGIVVYAGHETKSMLNNSGPRYKRSQVEQQMN--IDVIWCVIILLILCVVG 515
            .|...: :.......|||:|.|.||:|::|||.||.|...::.::|  ..|::|.::.|.|.:  
  Fly   433 TLWANT-VVAAGTATGIVIYTGCETRSVMNNSQPRSKVGLLDMEINGLTKVLFCAVLGLSLVM-- 494

  Fly   516 AIGCRMWLSSFTHFPVPYLPPNKLTANMESMW--IFWTYIVILQVMIPLSLYVTIELCKILQVFH 578
                 |.|..|                 ...|  ..:.::::...:||:||.|.:::.|....:.
  Fly   495 -----MMLKGF-----------------GGPWYRYMFRFVLLFSYIIPISLRVNLDMGKAFYSWQ 537

  Fly   579 IHNNVDLFDAETNKQTECRAMNITEELGQIQHIFTDKTGTLTENKMIFRRCVVNGSDYNHPPSEL 643
            :.|:.::      :.|..|:..|.||||:|.::.||||||||:|:|:|::  ::....:|.....
  Fly   538 MQNDSNI------QGTVVRSTTIPEELGRISYVLTDKTGTLTQNEMVFKK--IHLGIVSHDADTF 594

  Fly   644 EKIYSKPGAPAPPLIPNDNLNSDMAQLTQGTYLTPHAQRIQEFLVVLAICNTVIVGAAPHRDMMN 708
            ..|                                 .|.||:.                      
  Fly   595 HHI---------------------------------GQMIQKL---------------------- 604

  Fly   709 ASGIIEVQQIGNSPANLKHGKQRQKLLASSTSTTTTTTIINGPTTQPQVVSIPADRYIRLAESRS 773
             ||.|..||.|:              |:||:|        .|.:|:|.:......|.....|..:
  Fly   605 -SGNILQQQQGS--------------LSSSSS--------GGDSTKPMMFGNRMRRPEGWREWEA 646

  Fly   774 VTPSPPPNLLFALPAQSHQPTLSPISSSAESSPNSESESPSPPMKNKSLSNSISPTG----RAKA 834
            |.         || |..|..|           |.|:.|.      |:|:|.:.:.||    ..|:
  Fly   647 VR---------AL-ALCHNVT-----------PVSDDED------NRSVSTASTVTGGNNSPTKS 684

  Fly   835 VINSKITSIATFLNAKTQGKRMKLPSSKTGTIYRTADGRPLYEAESPDELALVNAAYSYDCCLLN 899
            |||                  ::.|.|        .|....|:|.||||:|||.........|:.
  Fly   685 VIN------------------IEAPGS--------TDTEHQYQAASPDEIALVKWTEQVGLTLIA 723

  Fly   900 RSPNQILVSMPMAGATRE----YEILKVLPFDSSRKCMSIVVRQIGSQEIVLYTKGAD---SSIM 957
            |..|.:.:.:.......:    |:||::.||.|..|.|.|:||:..:.:|..|.||||   |||:
  Fly   724 RDLNTMTLQVKTPSEDNDILLHYQILQLFPFTSESKRMGIIVRESKTGQITFYLKGADVVMSSIV 788

  Fly   958 PVLVPCSHNSPEGILREQTQQLLDRYAREGLRILVMAKRTLNSADYTDWWARHQEIEMSLENRER 1022
                  .:|.   .|.|::..:    ||||||.||:||:.|....|:|:..|:....:|:.:|..
  Fly   789 ------QYND---WLSEESGNM----AREGLRTLVVAKKVLTEEQYSDFETRYNAARLSITDRVA 840

  Fly  1023 RLRDSFAKLESNLTLLGATGIEDRLQDGVPETIASLLSAGISVWVLTGDKPETAINIAYSAKLF- 1086
            ::......||..|.||..||:|||||:.|..|:..|.:||:.||:|||||.|||..||.|::|. 
  Fly   841 KVAAVTESLERELELLCLTGVEDRLQENVRPTLELLRNAGVRVWMLTGDKLETACCIAKSSQLIG 905

  Fly  1087 -TQQMELIRLTARSRDAAETAINFYLTDMENDKTTSTLGYGQSLRKKQ-RALVVDGKTLTFILD- 1148
             .|.:.::| :.::|..|...:|                   |.|:|| .|||:.|::|...|. 
  Fly   906 RNQGLHVLR-SVKTRTDAHQELN-------------------SFRRKQGHALVISGESLEVCLQY 950

  Fly  1149 --PKSKLILPFLRLSKRCASVLCCRSTPLQKAYLVKVVKEELNLRTLAIGDGANDVSMIQMADVG 1211
              |:      ||.|:....:|:|||.:|.|||.:|.::::....||.|:|||.|||||||.||.|
  Fly   951 YRPE------FLELATASPAVVCCRCSPTQKAQVVALIQKHTGKRTCAVGDGGNDVSMIQQADAG 1009

  Fly  1212 VGISGQEGMQAVMAADFTLPRFRYLERLLLAHGYWCYDRLSRMILYFFYK-------NAAF--VF 1267
            |||.|:||.||.:|.||::|:|.::.:|||.||...|.|.:.:..:..::       .|.|  ||
  Fly  1010 VGIEGREGRQASLAGDFSIPQFSHIAKLLLIHGRRSYKRSAALSQFVIHRGLIITTLQAVFSAVF 1074

  Fly  1268 LIFWYQLYCGFSGQVMMDQMYLML-YNLIFTSLPPLAIGVYDKRVAEDLLLKNPYLYKN---GRL 1328
            .:....||.||          ||: |:.::|..|..:: |.|:.:..:..:..|.|||:   || 
  Fly  1075 YLSSVALYQGF----------LMVGYSTLYTMFPVFSL-VLDQDITSETAVTYPELYKDLSKGR- 1127

  Fly  1329 GVAYRPHDFWLILLDALYQSLVIFFVALCAYAESDVGIWEFGTTITASCL-FANLVHCAIEIRSW 1392
            .::|:....|:::  ::||..||.:.||..:.:..:.|    ..|:.|.| ...|:..|:.:|:|
  Fly  1128 SLSYKTFFIWVLI--SIYQGGVIMYGALILFVDEFIHI----VAISFSALIMTELIMVALTVRTW 1186

  Fly  1393 TVLHVLSIVLSLGSFYLFAIVYDSVCMNCFGVRSSYWVIFVCFASAVHWLVIMLSTVVAVLPRLL 1457
            ..|.||:.:.|| :.||.::          .|...|:.....::....|.|.:: |:|:.||..:
  Fly  1187 HRLMVLAELFSL-ALYLISL----------AVLHEYFDWEFIWSYDFLWKVSLI-TLVSCLPLYI 1239

  Fly  1458 LTTVRISLCPDDSTKV 1473
            :..:|....|....|:
  Fly  1240 IKFLRKKCSPPSYLKL 1255

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 18/50 (36%)
ATPase-Plipid 250..1473 CDD:273734 361/1266 (29%)
E1-E2_ATPase 302..>394 CDD:278548 35/93 (38%)
Cation_ATPase <880..965 CDD:289987 30/92 (33%)
HAD_like <1177..1240 CDD:304363 33/63 (52%)
PhoLip_ATPase_C 1223..1468 CDD:292829 66/259 (25%)
CG31729NP_609634.1 PhoLip_ATPase_N 227..279 CDD:292826 20/66 (30%)
ATPase-Plipid 228..1252 CDD:273734 362/1277 (28%)
E1-E2_ATPase 323..525 CDD:278548 67/233 (29%)
Cation_ATPase <704..783 CDD:289987 27/79 (34%)
HAD_like <975..1019 CDD:304363 25/44 (57%)
PhoLip_ATPase_C 1021..1249 CDD:292829 65/258 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C108078258
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24092
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.