DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33298 and CG9981

Sequence 1:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_001259610.1 Gene:CG9981 FlyBaseID:FBgn0030746 Length:1060 Species:Drosophila melanogaster

Alignment Length:1295 Identity:365/1296 (28%)
Similarity:573/1296 (44%) Gaps:334/1296 (26%)


  Fly   253 NKIRTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKE-----VAMIPVLFVLGV 312
            |::.|||||..:|:|.|..|||.|....||:.|.:      :|.|..|     |:::|:|||:.:
  Fly    28 NRVTTTKYTWFTFLPLNFYEQFRRAVYFYFLIITI------VSFFVNETISPLVSLLPLLFVMII 86

  Fly   313 TAVKDLFEDRRRRASDKRINNTTCRVYDGETERYKKVKWQELRVGDIVHLSNNETVPADILLLRT 377
            ||:|:..||..|..|||.:|  |.||......:.:.:..|.:..||:|.:.|:..||.|::||::
  Fly    87 TALKEGLEDYSRSKSDKLVN--TARVTVIRNGKEEIINSQFIVPGDLVVVRNDGDVPCDLVLLQS 149

  Fly   378 SDPQGVCYIDTCDLDGETNLKRREVVRGFEEMQSIFVPSKFV----------SRVEADAPTTKLY 432
            |.....|:::|.:||||||||            :|.||:.::          ..:..:..:..||
  Fly   150 SSADRKCFVNTANLDGETNLK------------TICVPTNYLLAGDHELQGKDCIVCEPSSADLY 202

  Fly   433 RFHGALI---------HPTGERVPISTECLLLRESRLKNTDYIEGIVVYAGHETKSMLNNSGPRY 488
            .|:|.|.         ...|:.:|::.:.||||..|:|:|:.:.|..:|.|..||..||:.....
  Fly   203 TFNGRLELRSGNDGAGSSAGDALPLTIDNLLLRGVRVKSTERVVGCAIYTGMHTKLQLNSRYTGN 267

  Fly   489 KRSQVEQQMNIDVIWCVIILLILCVVGAIGCRMWLSSFTHFP---VPYLPPNKLTANMESMW--- 547
            |.:..|:.:|..::..::.::::.||      ::|.. .|..   ||.:|......|..|.|   
  Fly   268 KSASSEKYINRFMVALIVGMIVVVVV------LYLIE-RHKEAKIVPTMPYQGPPTNFNSAWQIF 325

  Fly   548 -IFWTYIVILQVMIPLSLYVTIELCKILQVFHIHNNVDLFDAETNKQTECRAMNITEELGQIQHI 611
             .|.:::::...|:|:|.|:.||:.:|..:..:||::.|:|.||::.....|.|:.|||||:..:
  Fly   326 EDFLSFLLLFNYMVPISAYMNIEVYRIFGMHFMHNDLHLYDEETDQPCRVNASNLNEELGQVNIL 390

  Fly   612 FTDKTGTLTENKMIFRRCVVNGSDY----NHPPS-------ELEKIYSKPGAPAPPLIPNDNLNS 665
            |:|||||||:|.|.|..|.|.|::|    .|..|       ||||                 |::
  Fly   391 FSDKTGTLTKNLMKFVNCYVPGTNYQLQNTHLVSEGTDEKFELEK-----------------LDA 438

  Fly   666 DMAQLTQGTYLTPHAQRIQEFLVVLAICNTVIVGAAPHRDMMNASGIIEVQQIGNSPANLKHGKQ 730
            |.|.|.:                .||:|:||.|                :|::|:          
  Fly   439 DAAVLFE----------------ALAVCHTVEV----------------LQEVGD---------- 461

  Fly   731 RQKLLASSTSTTTTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQPTL 795
              |.|.||.|.:                                             .|||    
  Fly   462 --KTLESSESVS---------------------------------------------EQSH---- 475

  Fly   796 SPISSSAESSPNSESESPSPPMKNKSLSNSISPTGRAKAVINSKITSIATFLNAKTQGKRMKLPS 860
                                     .:|.:|...                               
  Fly   476 -------------------------LMSRNIVDR------------------------------- 484

  Fly   861 SKTGTIYRTADGRPLYEAESPDELALVNAAYSYDCCLLNRSPNQILVSMPMAGATR-EYEILKVL 924
                           |:|.||||.||:....|.. .:.....|.:|.......|.: :::.|.||
  Fly   485 ---------------YQASSPDEKALLEGCASLG-LVYEGQENDVLSICRYPSAEKVQFKRLHVL 533

  Fly   925 PFDSSRKCMSIVVRQIGSQEIVLYTKGADSSIMPVLVPCSHNSPEGILREQTQQLLDRYAREGLR 989
            .|.|.|:.||::||. .|..|.||:|||:|:|.|   .|. .||   |.|||...:.:||:.|||
  Fly   534 EFSSERQRMSVIVRD-QSDTIWLYSKGAESAIFP---RCK-ASP---LVEQTDAQITKYAQNGLR 590

  Fly   990 ILVMAKRTLNSADYTDWWARHQEIEMSLENRERRLRDSFAKLESNLTLLGATGIEDRLQDGVPET 1054
            .:.:.:|.|...:...:...:::....|.||...:...:..:|:.|.|||||.:||.||:.|.||
  Fly   591 TMAVGRRMLTDDELFHFEELYRKANTQLSNRNELIASCYETVENELDLLGATALEDALQEHVGET 655

  Fly  1055 IASLLSAGISVWVLTGDKPETAINIAYSAKLF---TQQMELIRLTARSRDAAETAINFYLTDMEN 1116
            :.:|.:||:.:|||||||.|||.||..:.:..   ::|..:|..|    :.||.....   ||..
  Fly   656 LEALQAAGLKIWVLTGDKVETAYNIGLACRHIPRGSKQHFIINTT----EPAELLARL---DMIG 713

  Fly  1117 DKTTSTLGYGQSLRKKQRALVVDGKTLTFILD--PKSKLILPFLRLSKRCASVLCCRSTPLQKAY 1179
            |             .:...|:|||.|:|.:|:  |:.     |..|:.||.:|||||.:||||:.
  Fly   714 D-------------DEPEVLIVDGTTITALLEHTPRQ-----FADLALRCRAVLCCRLSPLQKSE 760

  Fly  1180 LVKVVKEELNLRTLAIGDGANDVSMIQMADVGVGISGQEGMQAVMAADFTLPRFRYLERLLLAHG 1244
            :|.::|......|.|||||||||||||.|.:|:||:|:||.||...|||::.||..|.||.|.||
  Fly   761 IVTLIKRRKKYITAAIGDGANDVSMIQEAHIGIGITGREGKQAARCADFSIARFEMLRRLFLVHG 825

  Fly  1245 YWCYDRLSRMILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMYLMLYNLIFTSLPPLAIGVYDK 1309
            ::...||:.::|::.|||......:..||:|..:|...:.:.:||.|:::::.|.....:.:.||
  Fly   826 HYNSQRLAFLVLFYCYKNIIITGCMALYQVYDLYSATNVYNSIYLWLFDIVYISFSFTVLAICDK 890

  Fly  1310 RVAEDLLLKNPYLYK------NGRLGVAYRPHDFWLILLDALYQSLVIFFVALCAYAESDV---- 1364
            ..:|:.||.:|.|||      ...:||      |.|.:|:...|..:|||.......:::|    
  Fly   891 DYSEETLLSHPELYKPLAHNRQASMGV------FSLWILNGFVQCFIIFFFTYAMLNDANVLFNG 949

  Fly  1365 ----GIWEFGT-TITASCLFANLVHCAIEIRSWTVLHVLS------IVLSLGSFYLFAIVYDSVC 1418
                ....||| .||...:..||       :...|.|.::      |:.|:.:|.|...:|    
  Fly   950 GQTASFQTFGTMLITIIVIVGNL-------KLLLVAHYMTYRNFAMILASIAAFMLTTYLY---- 1003

  Fly  1419 MNCFGVRSSYWVIFVCFASAVHWLVIMLSTVVAVLPRLLLTTVRISLCPDDSTKVILQSK 1478
             |.:.....|.|.....:|...||..::.:|..:||..::..|.     |...||.|:||
  Fly  1004 -NLYTSGELYDVYNQFLSSLPIWLFTIICSVACLLPDFVIKVVN-----DMYRKVPLKSK 1057

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 18/46 (39%)
ATPase-Plipid 250..1473 CDD:273734 361/1289 (28%)
E1-E2_ATPase 302..>394 CDD:278548 33/92 (36%)
Cation_ATPase <880..965 CDD:289987 31/86 (36%)
HAD_like <1177..1240 CDD:304363 34/63 (54%)
PhoLip_ATPase_C 1223..1468 CDD:292829 68/266 (26%)
CG9981NP_001259610.1 PhoLip_ATPase_N 20..66 CDD:292826 17/44 (39%)
ATPase-Plipid 28..1051 CDD:273734 360/1288 (28%)
E1-E2_ATPase 84..>189 CDD:278548 37/119 (31%)
Cation_ATPase <489..568 CDD:289987 30/84 (36%)
HAD_like <758..807 CDD:304363 26/49 (53%)
PhoLip_ATPase_C 804..1050 CDD:292829 69/269 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C108532454
eggNOG 1 0.900 E1_COG0474
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24092
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.