DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33298 and SPAC24B11.12c

Sequence 1:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_592849.1 Gene:SPAC24B11.12c PomBaseID:SPAC24B11.12c Length:1402 Species:Schizosaccharomyces pombe

Alignment Length:1431 Identity:432/1432 (30%)
Similarity:651/1432 (45%) Gaps:359/1432 (25%)


  Fly   250 FVGNKIRTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKEV----AMIPVLFVL 310
            |..|||||.|||.:.|||||:..||..||||:|:|:|:|.   .||.||::|    |.:|::.|:
pombe    85 FPRNKIRTAKYTPIDFIPKNIFLQFQNVANLFFLFLVILQ---SISIFGEQVNPGLAAVPLIVVV 146

  Fly   311 GVTAVKDLFEDRRRRASDKRINNT-TCRV------------------------------------ 338
            |:|||||..||.||...|..:||| |.|:                                    
pombe   147 GITAVKDAIEDFRRTMLDIHLNNTPTLRLSHYQNPNIRTEYISYFRRFKKRISALFRVFLAKQEE 211

  Fly   339 ------------------------YDG------ETER---------------------------- 345
                                    ||.      |.:|                            
pombe   212 KKRAKRLNDAVPLEDMAGSESRPSYDSIFRESFEAKRSFEDSKGKVPLSALDGTATILQSRPMDI 276

  Fly   346 ------------YKKVKWQELRVGDIVHLSNNETVPADILLLRTSDPQGVCYIDTCDLDGETNLK 398
                        :||..|:::||||.|.:.:|:.:||||:::.:|||:|:|||:|.:||||||||
pombe   277 IDYEAEATGECHFKKTYWKDVRVGDFVKVMDNDEIPADIVIINSSDPEGICYIETKNLDGETNLK 341

  Fly   399 RREVVRGFEEMQSIFVPSKFVSR----VEADAPTTKLYRFHGA---LIH------PTGERV--PI 448
            .|..:...:.:    |......|    :|::.|...||.::||   .:|      .|.:.|  ||
pombe   342 MRHALTCGKNV----VDEASCERCRFWIESEPPHANLYEYNGACKSFVHSEAGGSDTSQTVSEPI 402

  Fly   449 STECLLLRESRLKNTDYIEGIVVYAGHETKSMLNNSGPRYKRSQVEQQMNIDVIWCVIILLILC- 512
            |.:.:|||...|:||.::.|:||:.|.:||.|||:..|..|||::.:.:|.:|....|||..:| 
pombe   403 SLDSMLLRGCVLRNTKWVIGVVVFTGDDTKIMLNSGAPPLKRSRITRNLNWNVYLNFIILFSMCF 467

  Fly   513 ---VVGAIGCRMWLSSFTHFPVPYL--PPNKLTANMESMWIFWTYIVILQVMIPLSLYVTIELCK 572
               ||..|..|....|..:|....:  .|.|     :.:..|:|.:::.|.::|:|||::||:.|
pombe   468 VCAVVEGIAWRGHSRSSYYFEFGSIGGSPAK-----DGVVTFFTGVILFQNLVPISLYISIEIVK 527

  Fly   573 ILQVFHIHNNVDLFDAETNKQTECRAMNITEELGQIQHIFTDKTGTLTENKMIFRRCVVNGSDYN 637
            .:|...|:.:.|::..:.......::.||:::|||:::||:|||||||:|.|.|::|.:||..|.
pombe   528 TIQAIFIYFDKDMYYKKLKYACTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVAYG 592

  Fly   638 HPPSE-LEKIYSKPGAPAPPLIPNDNLNSDMAQLTQGTYLTPHAQRIQEFLVVLAICNTVIVGAA 701
            ...:| :..:..:.|             .|..:||        .|: |.|:              
pombe   593 EAFTEAMAGMAKREG-------------KDTEELT--------LQK-QSFI-------------- 621

  Fly   702 PHRDMMNASGIIEVQQIGNSPANLKHGKQRQKLLASSTSTTTTTTIIN---GPTTQPQVVSIPAD 763
             .||.|..     :.|:.|...|        |.|.....|..::..::   |...:.|.::. .:
pombe   622 -ERDRMQM-----ISQMRNMHDN--------KYLVDDNLTFISSQFVHDLAGKAGEEQSLAC-YE 671

  Fly   764 RYIRLAESRSVTPSPPPNLLFALPAQSHQPTLSPISSSAESSPNSESESPSPPMKNKSLSNSISP 828
            .::.||...||...                                                   
pombe   672 FFLALALCHSVVAD--------------------------------------------------- 685

  Fly   829 TGRAKAVINSKITSIATFLNAKTQGKRMKLPSSKTGTIYRTADGRPLYEAESPDELALVNAAYSY 893
                                                   |..| |.:|:|:||||.|||..|...
pombe   686 ---------------------------------------RVGD-RIVYKAQSPDEAALVGTARDV 710

  Fly   894 DCCLLNRSPNQILVSMPMAGATREYEILKVLPFDSSRKCMSIVVRQIGSQEIVLYTKGADSSIMP 958
            ....|::. ..|:|:..: |.|:.::::..:.|.|:||.||::|:. .....||..|||||.|..
pombe   711 GFVFLDQR-RDIMVTRAL-GETQRFKLMDTIEFSSARKRMSVIVKG-PDNRYVLICKGADSIIFE 772

  Fly   959 VLVPCSHNSPEGILREQTQQLLDRYAREGLRILVMAKRTLNSADYTDWWARHQEIEMSLENRERR 1023
            .|.|    :.:..||:.|.:.|..:|.||||.|.:|||.|...:|.:|..::.....::||||.:
pombe   773 RLEP----NEQVELRKTTSEHLRIFALEGLRTLCIAKRELTEEEYYEWKEKYDIAASAIENREEQ 833

  Fly  1024 LRDSFAKLESNLTLLGATGIEDRLQDGVPETIASLLSAGISVWVLTGDKPETAINIAYSAKLFTQ 1088
            :.:....:||:|||||.|.||||||:|||::||.|..|||.:|||||||.||||||.:|..|...
pombe   834 IEEVADLIESHLTLLGGTAIEDRLQEGVPDSIALLAQAGIKLWVLTGDKMETAINIGFSCNLLDA 898

  Fly  1089 QMELIRLTAR---SRDAAETAINFYL----------TDMENDKTTSTLGYGQSLRKKQRALVVDG 1140
            .|::|:....   |....|..:..||          .::|..|.......|      ..|||:||
pombe   899 GMDMIKFDVDQEVSTPELEVILADYLYRYFGLSGSVEELEAAKKDHDTPSG------SHALVIDG 957

  Fly  1141 KTLTFILDPKSKLILPFLRLSKRCASVLCCRSTPLQKAYLVKVVKEELNLRTLAIGDGANDVSMI 1205
            ..|..:||  ..:...||.|.|||.:|||||.:|.|||.:|::|:|.|.:.|||||||||||:||
pombe   958 SVLKRVLD--GPMRTKFLLLCKRCKAVLCCRVSPAQKADVVQLVRESLEVMTLAIGDGANDVAMI 1020

  Fly  1206 QMADVGVGISGQEGMQAVMAADFTLPRFRYLERLLLAHGYWCYDRLSRMILYFFYKNAAFVFLIF 1270
            |.||:||||.|:||..|.|:||:.:.:||:|.:|:|.||.|.|:|::.|:..||||:..:.|.:|
pombe  1021 QKADIGVGIVGEEGRAAAMSADYAIGQFRFLSKLVLVHGRWDYNRVAEMVNNFFYKSVVWTFTLF 1085

  Fly  1271 WYQLYCGFSGQVMMDQMYLMLYNLIFTSLPPLAIGVYDKRVAEDLLLKNPYLYKNGRLGVAYRPH 1335
            |||:|..|....:.|..|:||:||||:|||.:.:||||:.|..||.|:.|.|||.|.|.:.....
pombe  1086 WYQIYNNFDANYLFDYTYVMLFNLIFSSLPVIVMGVYDQDVNADLSLRIPQLYKRGILQLNSARK 1150

  Fly  1336 DFWLILLDALYQSLVIFF--------VALCAYAESD-VGIWEFGTTITASCLFANLVHCAIEIRS 1391
            .|...:||..|||::.||        |...|....| :.:.:.|..:.|..:.....:..:...:
pombe  1151 IFIGYMLDGFYQSVICFFFSFLVINNVTTAAQNGRDTMAVQDLGVYVAAPTIMVVDTYVILNQSN 1215

  Fly  1392 WTVLHVLSIVLSLGSFYLFAIVYDSVCMNCFGVRSSYWVIFVCFASAV-----HWLVIMLSTVVA 1451
            |.|..:....||..:|:.:..||.         :|.|...|...||.:     .|.|:..:.|..
pombe  1216 WDVFSIGLWALSCLTFWFWTGVYS---------QSLYTYEFYKSASRIFRTPNFWAVLCGTIVSC 1271

  Fly  1452 VLPRLLLTTVRISLCPDDSTKVILQSKR----------ERSRGEALLVTWSRST-------SASS 1499
            :.|:.|..|.:....|.| ..:|.:|.|          |..........|:.||       |:||
pombe  1272 LFPKFLFMTTQKLFWPYD-VDIIRESYRTKRLHELDEEEEIENAEQSPDWASSTLQVPFNASSSS 1335

  Fly  1500 I 1500
            :
pombe  1336 L 1336

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 28/49 (57%)
ATPase-Plipid 250..1473 CDD:273734 422/1386 (30%)
E1-E2_ATPase 302..>394 CDD:278548 47/199 (24%)
Cation_ATPase <880..965 CDD:289987 30/85 (35%)
HAD_like <1177..1240 CDD:304363 37/63 (59%)
PhoLip_ATPase_C 1223..1468 CDD:292829 82/259 (32%)
SPAC24B11.12cNP_592849.1 ATPase-Plipid 85..1295 CDD:273734 423/1389 (30%)
PhoLip_ATPase_N <85..129 CDD:292826 26/47 (55%)
Cation_ATPase 678..773 CDD:289987 35/189 (19%)
COG4087 <989..1045 CDD:226572 35/56 (63%)
PhoLip_ATPase_C 1038..1287 CDD:292829 81/258 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.870

Return to query results.
Submit another query.