DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33298 and Atp10d

Sequence 1:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_700438.3 Gene:Atp10d MGIID:2450125 Length:1469 Species:Mus musculus

Alignment Length:1464 Identity:573/1465 (39%)
Similarity:824/1465 (56%) Gaps:224/1465 (15%)


  Fly   170 PAREPSAPTS-ATGGR----------GHSRQASRSESIYTLRRTEAPPW----WKRLTLCNYNTG 219
            ||...|||.| .|.|.          |..|....:.|...|..||...|    |:||   ::...
Mouse    12 PALWISAPFSFGTLGSEVTPCWDERPGRDRSPEPAGSPCVLGMTELLQWARHHWRRL---SHGRA 73

  Fly   220 DKFEERSY----------------------RTVVPNHTVPPKTPKRDHPNGQFVGNKIRTTKYTL 262
            ...:||.|                      |.|:|:  :.....:.:..:|.:|.|:||||||||
Mouse    74 QGEDERPYNYASLLACGGKSSRTPRPAGKHRVVIPH--LQCFKDEYERFSGTYVNNRIRTTKYTL 136

  Fly   263 LSFIPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKEVAMIPVLFVLGVTAVKDLFEDRRRRAS 327
            |:|:|:||.|||||.|||||:|:|:|||||.:.||.||:.|:|::.||.:.|:||..||.|:...
Mouse   137 LNFVPRNLFEQFHRAANLYFLFLVVLNWVPLVEAFQKEITMLPLVVVLTIIAIKDGLEDYRKYKI 201

  Fly   328 DKRINNTTCRVYDGETERYKKVKWQELRVGDIVHLSNNETVPADILLLRTSDPQGVCYIDTCDLD 392
            ||:|||...:||..:.::|....|:.:.|||.:.||.||.:|||::||.::||.|:|:|:|..||
Mouse   202 DKQINNLITKVYSRKEKKYIDCCWKNVTVGDFIRLSCNEIIPADMVLLFSTDPDGICHIETSGLD 266

  Fly   393 GETNLKRREVVRGFEEMQSIFVPSKFVSRVEADAPTTKLYRFHGALIHPTGERVPISTECLLLRE 457
            ||:|||:|:||||:.|..|...|.||.||:|.::|...|.||.|.|.|...|||.:|.|.||||.
Mouse   267 GESNLKQRQVVRGYTEQDSEVDPEKFSSRIECESPNNDLSRFRGFLEHANKERVGLSKENLLLRG 331

  Fly   458 SRLKNTDYIEGIVVYAGHETKSMLNNSGPRYKRSQVEQQMNIDVIWCVIILLILCVVGAIGCRMW 522
            ..::||:.:.|||||||||||:||||||||||||::|::.|.||:|||::|:::|:.||:|..:|
Mouse   332 CTIRNTEAVVGIVVYAGHETKAMLNNSGPRYKRSKLERRANTDVLWCVLLLIVMCLTGALGHGIW 396

  Fly   523 LSSFTH---FPVPYLPPNKLTANMESMWIFWTYIVILQVMIPLSLYVTIELCKILQVFHIHNNVD 584
            ||.:.:   |.:|......::..:...::|||.|::|||:||:||||:||:.|:.|::.|.::||
Mouse   397 LSRYENMLFFNIPEPDGRVISPVLTGFYVFWTMIILLQVLIPISLYVSIEIVKLGQIYFIQSDVD 461

  Fly   585 LFDAETNKQTECRAMNITEELGQIQHIFTDKTGTLTENKMIFRRCVVNGSDYNHPP--------- 640
            .::.:.:...:|||:||||:|||||::|:|||||||||||:||||.|.|.||.|..         
Mouse   462 FYNEKMDSTIQCRALNITEDLGQIQYLFSDKTGTLTENKMVFRRCSVAGFDYCHEENAKRLESYQ 526

  Fly   641 ---SELEKI----------YSKPGAPAPPLIPNDNLNSDMAQLT---------QGTYLTPHAQR- 682
               ||.|:.          .::|.|.....:|:..|....|||:         :|:...||::: 
Mouse   527 EAVSEEEECTDTLGGSLSNMARPRAQGCRTVPSGPLGKPSAQLSGSTSAVGNGEGSGEVPHSRQA 591

  Fly   683 --------------------------------------------IQEFLVVLAICNTVIVGAAPH 703
                                                        |.:|.:.|||||||:|.|.  
Mouse   592 AFSSPMETDVVPDTRLLDKFSQLTPQLLTGLDGTAQSSPLETLYIMDFFIALAICNTVVVSAP-- 654

  Fly   704 RDMMNASGIIEVQQIGNSPANLKHGKQRQKLLASSTSTTTTTTIINGPTTQPQVVSIPADRYIRL 768
                            |.|        |||:..||.......::               :....:
Mouse   655 ----------------NQP--------RQKIGLSSLGGMPIKSL---------------EEIKNI 680

  Fly   769 AESRSVTPSPPPNLLFALPAQSHQPTLSPISSSAESSPNSESESPSPPMKNKSLSNSISPTGRAK 833
            .:..||..|..|:|.....:.|..|.......|..|.|..     ||||:::|......|     
Mouse   681 FQKLSVRRSSSPSLASGKDSSSGTPCAFVSRISFFSRPKL-----SPPMEDESSQMDEIP----- 735

  Fly   834 AVINSKITSIATFLNAKTQGKRMKLPSSKTGTIYRTADGRP------LYEAESPDELALVNAAYS 892
                 :.::.|.....:.|.:.:.|..|....:    .|.|      .||||||||.|||.||.:
Mouse   736 -----QASNSACCTETEAQNRAVGLSVSSAEAL----SGPPPSASNLCYEAESPDEAALVYAARA 791

  Fly   893 YDCCLLNRSPNQILVSMPMAGATREYEILKVLPFDSSRKCMSIVVRQIGSQEIVLYTKGADSSIM 957
            |.|.|.:|:|.|::|.....|:. .:::|.:|||||.||.||:|||...|:::|:|||||||.||
Mouse   792 YRCTLQSRTPEQVMVDFAALGSL-TFQLLHILPFDSVRKRMSVVVRHPLSKQVVVYTKGADSVIM 855

  Fly   958 PVLVPCSHN--SPEG--ILREQTQQLLDRYAREGLRILVMAKRTLNSADYTDWWARHQEIEMSLE 1018
            .:|...:.:  :||.  |:||:||:.||.||:.|||.|.:||:.::..:|.:|...|...|.|::
Mouse   856 ELLSVAASDGTNPEQQMIIRERTQRHLDEYAKRGLRTLCVAKKVMSDTEYAEWLRNHFLAETSID 920

  Fly  1019 NRERRLRDSFAKLESNLTLLGATGIEDRLQDGVPETIASLLSAGISVWVLTGDKPETAINIAYSA 1083
            |||..|.:|..:||:.||||||||||||||:||||:|.:|..|||.:|:|||||.|||:||||:.
Mouse   921 NREELLVESAMRLENKLTLLGATGIEDRLQEGVPESIEALHQAGIKIWMLTGDKQETAVNIAYAC 985

  Fly  1084 KLFTQQMELIRLTARSRDAAETAINFYLTDMEN---------------DKTTSTLGYGQSLRKKQ 1133
            ||.....:|..|..:|:||....::..|.:::.               .:.:...|.|::     
Mouse   986 KLLEPDDKLFILNTQSQDACGMLMSAILEELQKRAQVSPELASSRKNFPQPSDAQGQGRA----- 1045

  Fly  1134 RALVVDGKTLTFILDPKSKLILPFLRLSKRCASVLCCRSTPLQKAYLVKVVKEELNLRTLAIGDG 1198
             .||:.||||.|.|  :..|...||.|:..|.:|:|||:|||||:.:||:|:...::.||.||||
Mouse  1046 -GLVITGKTLEFAL--QESLQRQFLELTAWCQAVICCRATPLQKSEVVKLVRNHHHVLTLPIGDG 1107

  Fly  1199 ANDVSMIQMADVGVGISGQEGMQAVMAADFTLPRFRYLERLLLAHGYWCYDRLSRMILYFFYKNA 1263
            ||||||||:||:|:|:|||||||||||:||.:.:||:|.:|||.||:|||.|||.|||||||||.
Mouse  1108 ANDVSMIQVADIGIGVSGQEGMQAVMASDFAISQFRHLSKLLLVHGHWCYTRLSNMILYFFYKNV 1172

  Fly  1264 AFVFLIFWYQLYCGFSGQVMMDQMYLMLYNLIFTSLPPLAIGVYDKRVAEDLLLKNPYLYKNGRL 1328
            |:|.|:||||.:|||||..|.|...|:.:||:|||:||:..||.:|.|:.:.||:.|.||::|:.
Mouse  1173 AYVNLLFWYQFFCGFSGTSMTDYWVLIFFNLLFTSVPPIIYGVLEKDVSAETLLQLPELYRSGQR 1237

  Fly  1329 GVAYRPHDFWLILLDALYQSLVIFFVALCAYAESDVGIWEFGTTITASCLFANLVHCAIEIRSWT 1393
            ...|.|..||:.||||.|||||.|||....|..||:.|:.||..:..:.||..|:|..||.:|.|
Mouse  1238 SEEYLPLTFWITLLDAFYQSLVCFFVPYFTYQGSDIDIFTFGNPLNTAALFIILLHLVIESKSLT 1302

  Fly  1394 VLHVLSIVLSLGSFYLFAIVYDSVCMNCFGVRSSYWVIFVCFASAVHWLVIMLSTVVAVLPRLLL 1458
            .:|:|..|.|:.|::.||:.:.::|:.|....:.|.::.......|.:||.:|:|.||:|||.|.
Mouse  1303 WIHMLVTVGSILSYFFFALAFGALCVTCNPPSNPYGIMRKHMLDPVFYLVCVLTTFVALLPRFLY 1367

  Fly  1459 TTVRISLCPDDSTKVILQSK-----RERSRGEAL 1487
            ..::.|:.|..    :|::|     ....|.|||
Mouse  1368 RVLQGSVFPSP----VLRAKYFDRLPPEERAEAL 1397

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 34/50 (68%)
ATPase-Plipid 250..1473 CDD:273734 542/1327 (41%)
E1-E2_ATPase 302..>394 CDD:278548 40/92 (43%)
Cation_ATPase <880..965 CDD:289987 42/85 (49%)
HAD_like <1177..1240 CDD:304363 39/63 (62%)
PhoLip_ATPase_C 1223..1468 CDD:292829 113/245 (46%)
Atp10dNP_700438.3 ATPase-Plipid 124..1377 CDD:273734 542/1322 (41%)
PhoLip_ATPase_N <124..175 CDD:292826 36/51 (71%)
E1-E2_ATPase 181..406 CDD:278548 111/225 (49%)
Cation_ATPase <779..859 CDD:289987 42/81 (52%)
HAD_like <1101..1132 CDD:304363 26/31 (84%)
PhoLip_ATPase_C 1132..1377 CDD:292829 113/245 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 993 1.000 Inparanoid score I302
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000836
OrthoInspector 1 1.000 T616067
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24092
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3512
TreeFam 00.000 Not matched by this tool.
88.100

Return to query results.
Submit another query.