DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33298 and tat-4

Sequence 1:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_495244.1 Gene:tat-4 WormBaseID:WBGene00020784 Length:1454 Species:Caenorhabditis elegans

Alignment Length:1288 Identity:461/1289 (36%)
Similarity:679/1289 (53%) Gaps:176/1289 (14%)


  Fly   219 GDKFEERSYRTVVPNHTVPPKTPKRDHPN-GQFVGNKIRTTKYTLLSFIPKNLLEQFH-RVANLY 281
            |....|...|.:.|||..  ::|:.:..| ..|..|:|.|||||..:|||.|:..|.. :.||||
 Worm    33 GRSNRETGSRVIRPNHLF--ESPRYELNNYRDFTDNRISTTKYTFWNFIPLNIWHQVSTKYANLY 95

  Fly   282 FIFIVLLNWVPEISAFGKEVAMIPVLFVLGVTAVKDLFEDRRRRASDKRINNTTCRVYDGETERY 346
            ||||.:|||||...|:.:.|.:||:.||||.|.:||..||.||...|.:||..||.|:|.:...:
 Worm    96 FIFIAILNWVPFFDAYTRYVGLIPICFVLGTTLIKDGIEDYRRYKFDNQINKKTCHVWDRDRCAF 160

  Fly   347 KKVKWQELRVGDIVHLSNNETVPADILLLRTSDPQGVCYIDTCDLDGETNLKRREV---VRGFEE 408
            :|.:|:.:.|||.||:|||:.|||||:|||:|...|.|||:||:|||||:||:|.|   |..:.:
 Worm   161 RKTEWRYILVGDFVHISNNQDVPADIILLRSSSESGTCYIETCNLDGETSLKQRMVPAKVIDYSK 225

  Fly   409 MQSIFVPSKFVSRVEADAPTTKLYRFHGALIHPTGERVPISTECLLLRESRLKNTDYIEGIVVYA 473
            ..|.|.|..|...|..:.|...:|.....:....|:...|..|.:|||.||:|||.::|||||||
 Worm   226 KDSTFKPPDFTGVVTCEKPDKSIYTIRAKVEFEPGQSDVIIKENMLLRGSRIKNTTFVEGIVVYA 290

  Fly   474 GHETKSMLNNSGPRYKRSQVEQQMNIDVIWCVIILLILCVVGAIGCRMWLSSFTHFPV----PYL 534
            ||:||.|.||....:|.|.:|:..|..:|.|.|:||::.:.|||...:|:.   ..||    |::
 Worm   291 GHDTKVMQNNGRAPHKTSGIEKLTNKFIIACFIMLLLMVLYGAITSAVWVG---QHPVDEQIPFI 352

  Fly   535 PPNKLTANMESMWIFWTYIVILQVMIPLSLYVTIELCKILQVFHIHNNVDLFDAETNKQTECRAM 599
            ..|.....:|.......:.:..|:::|:|||:|:|:.|.||::.|.|::.|:|.::::..:||::
 Worm   353 LSNTPRPFIEGFIGIGAFFINYQLLVPISLYITVEIIKALQIYFISNDIQLYDQKSDRAIDCRSL 417

  Fly   600 NITEELGQIQHIFTDKTGTLTENKMIFRRCVVNGSDYNHPPSELEKIYSKPGAPAPPLIPNDNLN 664
            :|.||||.:.|:.:|||||||||.||||.|..:.:||....|:     |.|..|    :.:|.|.
 Worm   418 SIPEELGTVTHVLSDKTGTLTENMMIFRNCAFDETDYGSNGSQ-----SNPDKP----VKSDELY 473

  Fly   665 SDMAQLTQGTYLTPHAQRIQE-FLVVLAICNTVIVGAAPHRDMM---NASGIIEVQQIGNSP-AN 724
            ..:        ||.....:|: |...:.:.|:|:|...||.|::   |..|  .|..||||. .:
 Worm   474 QRI--------LTSMQNPVQKHFFANILLNNSVVVNHIPHTDVLELGNFDG--GVYNIGNSCFYD 528

  Fly   725 LKHGKQRQKLLASSTSTTTTTTIINGPTTQPQVVSIPA------DRYIRLAESRSVTPSPPPNLL 783
            :...|.:|||.|....     .:.:...::|..:.:|.      ||...:.|..:.:.||.|   
 Worm   529 VTEEKYKQKLAAIGKG-----GVDDDDVSRPDELGLPTTSIQFDDRLTVIVEEDTPSDSPAP--- 585

  Fly   784 FALPAQSHQPTLSPISSSAESSPNSESESPSPPMKNKSLSNSISPTGRAKAVINSKITSIATFLN 848
                               ::||....|:|:|          .||       |...::|:::|  
 Worm   586 -------------------DASPRDLPETPTP----------TSP-------IYRPLSSLSSF-- 612

  Fly   849 AKTQGKRMKLPSSKTGTIYRTADGRPL--------------------YEAESPDELALVNAAYSY 893
                       |.|..|:.|.:..||:                    |||||||||||:..|..|
 Worm   613 -----------SRKLSTVVRRSILRPISDIIPVRKRLISFKQQAMNPYEAESPDELALIEGAALY 666

  Fly   894 DCCLLNRSPNQILVSMPMAGATREYEILKVLPFDSSRKCMSIVVRQIGSQE-IVLYTKGADSSIM 957
            |..||.|:...:.:|.| ..|.:.||||..||||::||.||::|   .||: .::|.|||||:|:
 Worm   667 DYVLLERAATSVTISTP-EKAEKRYEILLTLPFDATRKRMSVIV---NSQKGPLMYCKGADSAII 727

  Fly   958 PVLVPCSHNSPEGILREQTQQL---LDRYAREGLRILVMAKRTLNSADYTDWWARHQEI-EMSLE 1018
                  |..|.:.:..::.|.|   ||.||::|||.|..|.:.::..|:.|:...::.: |.:..
 Worm   728 ------SRLSSDSLESKRVQDLKDHLDNYAKKGLRTLCFAMKYISKEDFEDFLDSYRFLMEDATS 786

  Fly  1019 NRERRLRDSFAKLESNLTLLGATGIEDRLQDGVPETIASLLSAGISVWVLTGDKPETAINIAYSA 1083
            .||:.|.:...:||:||.|.|.||||||||||||:|:.:|..|||.||||||||.|||.|||.|:
 Worm   787 EREKMLSEKADELETNLKLSGVTGIEDRLQDGVPDTLRALRDAGIQVWVLTGDKLETAQNIATSS 851

  Fly  1084 KLFTQQMELIRLTARSRDAAETAINFYLTDMENDKTTSTLGYGQSLRKKQRALVVDGKTLTFILD 1148
            .||..|        ||....||.     ||.|....::.|.           :::....:....|
 Worm   852 GLFHPQ--------RSLKVIETE-----TDAEEASESAGLN-----------IIMSPAAIRLAQD 892

  Fly  1149 PKSKLILPFLRLSKRCASVLCCRSTPLQKAYLVKVVKEELNLRTLAIGDGANDVSMIQMADVGVG 1213
            ..:.|    :...|:..:|||.|.||.:||.:|..||:.:....||||||||||.|||.|.||:|
 Worm   893 GNAHL----MEALKKAKTVLCYRMTPSEKATIVNTVKKRIKGNVLAIGDGANDVPMIQAAHVGIG 953

  Fly  1214 ISGQEGMQAVMAADFTLPRFRYLERLLLAHGYWCYDRLSRMILYFFYKNAAFVFLIFWYQLYCGF 1278
            |:|:||:||.||.||.:.||::|.||||.||:|.|.||:...|||.||||..||:||:||.|.|.
 Worm   954 IAGKEGLQAAMACDFAIARFKFLSRLLLVHGHWSYYRLANTFLYFLYKNANAVFIIFYYQFYNGA 1018

  Fly  1279 SGQVMMDQMYLMLYNLIFTSLPPLAIGVYDKRVAEDLLLKNPYLYKNGRLGVAYRPHDFWLILLD 1343
            ||..::|.::.::|.:||||:.|:.:||.|:...:..|:..|.||..||....|....|:..::|
 Worm  1019 SGTNIVDPIWGVIYPIIFTSVQPVVVGVLDQDYDDQTLMNKPELYVIGRENQLYTWKHFFRDVID 1083

  Fly  1344 ALYQSLVIFFVALCAYAESDVGIWEFGTTITASCLFANLVHCAIEIRSWTVLHVLSIVLSLGSFY 1408
            .:||:.||::||......|...:||.|..|..|.:..|..|.|:::|.|   |..  :::|.||:
 Worm  1084 GIYQAAVIYYVAYLTLDNSTSSLWEMGFYIATSSILVNSGHLALQVRYW---HWQ--LVALFSFF 1143

  Fly  1409 L---FAIVYDSVCMNCFGVR---SSYWVIFVCFASAVHWLVIMLSTVVAVLPR 1455
            :   ||..: :.|:......   ...|:..........|....::.:||:.||
 Worm  1144 ILFNFAFFF-AECLTAAAAMVPDPPVWMPIHAMGDPRFWYYQFITVIVALCPR 1195

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 27/51 (53%)
ATPase-Plipid 250..1473 CDD:273734 453/1257 (36%)
E1-E2_ATPase 302..>394 CDD:278548 48/92 (52%)
Cation_ATPase <880..965 CDD:289987 39/86 (45%)
HAD_like <1177..1240 CDD:304363 37/63 (59%)
PhoLip_ATPase_C 1223..1468 CDD:292829 83/240 (35%)
tat-4NP_495244.1 PhoLip_ATPase_N 56..114 CDD:292826 28/58 (48%)
ATPase-Plipid 63..1195 CDD:273734 452/1255 (36%)
Cation_ATPase <653..732 CDD:289987 40/89 (45%)
HAD_like <782..961 CDD:304363 88/207 (43%)
PhoLip_ATPase_C 963..1195 CDD:292829 82/238 (34%)
GyrI-like 1258..1404 CDD:283980
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D37083at33208
OrthoFinder 1 1.000 FOG0000836
OrthoInspector 1 1.000 T374893
orthoMCL 1 0.900 OOG5_128792
Panther 1 1.100 O PTHR24092
Phylome 1 0.910 0.685 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.780

Return to query results.
Submit another query.