DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33298 and Atp10a

Sequence 1:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster
Sequence 2:NP_033858.2 Gene:Atp10a MGIID:1330809 Length:1508 Species:Mus musculus

Alignment Length:1415 Identity:582/1416 (41%)
Similarity:808/1416 (57%) Gaps:216/1416 (15%)


  Fly   167 KEEPAREPSAPTSATGGRGHSRQASRSESIYTLRRTEAPPWWKRLTLCNYNTGDKFEERSYRTVV 231
            :|.||.|.||   ::|.|...|           ||      |:..|               |||.
Mouse     3 RELPAAEESA---SSGWRRPRR-----------RR------WEGRT---------------RTVR 32

  Fly   232 PNHTVPP---KTPKRDHPNGQ----------FVGNKIRTTKYTLLSFIPKNLLEQFHRVANLYFI 283
            .| .:||   :......|.|:          ...|:::|||||||||:||||.|||||:||:||:
Mouse    33 SN-LLPPLGTEDSTIGAPKGERLLMRGCIQHLADNRLKTTKYTLLSFLPKNLFEQFHRLANVYFV 96

  Fly   284 FIVLLNWVPEISAFGKEVAMIPVLFVLGVTAVKDLFEDRRRRASDKRINNTTCRVYDGETERYKK 348
            ||.|||:||.::||...:|:.||||:|.|||:|||:||..|..||..||:..|.|:..|.::|..
Mouse    97 FIALLNFVPAVNAFQPGLALAPVLFILAVTAIKDLWEDYSRHRSDHEINHLGCLVFSREEKKYVN 161

  Fly   349 VKWQELRVGDIVHLSNNETVPADILLLRTSDPQGVCYIDTCDLDGETNLKRREVVRGFEEMQSIF 413
            ..|:|:||||.|.|..||.:|||||||.:|||.|:|:|:|.:||||||||||:|||||.|:.|.|
Mouse   162 RYWKEIRVGDFVRLCCNEIIPADILLLSSSDPDGLCHIETANLDGETNLKRRQVVRGFSELVSEF 226

  Fly   414 VPSKFVSRVEADAPTTKLYRFHGALIHPTGERVPISTECLLLRESRLKNTDYIEGIVVYAGHETK 478
            .|..|.|.:|.:.|...|.||.|.::|..||:..:..|.||||...::||:.:.|||:|||||||
Mouse   227 NPLTFTSVIECEKPNNDLSRFRGYIMHSNGEKAGLHKENLLLRGCTIRNTEAVAGIVIYAGHETK 291

  Fly   479 SMLNNSGPRYKRSQVEQQMNIDVIWCVIILLILCVVGAIGCRMWLSSFTH----FPVPYLPPNKL 539
            ::||||||||||||:|:|||.||:|||::|:.:.:..|:|..:|:..:..    |.||....:.|
Mouse   292 ALLNNSGPRYKRSQLERQMNCDVLWCVLLLVCISLFSAVGHGLWVRRYQEKKALFDVPESDGSSL 356

  Fly   540 TANMESMWIFWTYIVILQVMIPLSLYVTIELCKILQVFHIHNNVDLFDAETNKQTECRAMNITEE 604
            :....:::.|:|.|::|||:||:||||:||:.|:.||:.|:.:::|:|.||:.|.:|||:||||:
Mouse   357 SPATAAVYSFFTMIIVLQVLIPISLYVSIEIVKVCQVYFINQDIELYDEETDSQLQCRALNITED 421

  Fly   605 LGQIQHIFTDKTGTLTENKMIFRRCVVNGSDYNH------------PPSELEKIYSKPG------ 651
            ||||::||:|||||||||||:||||.|:|.:|:|            ..||.|::.||.|      
Mouse   422 LGQIKYIFSDKTGTLTENKMVFRRCTVSGIEYSHDANAQRLARYQEADSEEEEVVSKVGTISHRG 486

  Fly   652 ---------------------------------------APAPP----LIPNDNLNSDMAQLTQG 673
                                                   |.:.|    :.|:..|...:::..:.
Mouse   487 STGSHQSIWMTHKTQSIKSHRRTGSRAEAKRASMLSKHTAFSSPMEKDITPDPKLLEKVSECDRF 551

  Fly   674 -----------TYLTPHAQRIQEFLVVLAICNTVIVGAAPHRDMMNASGIIEVQQIGNSPANLKH 727
                       .:|:|....:.:|.:.|.|||||:|                     .||     
Mouse   552 LAIARHQEHPLAHLSPELSDVFDFFIALTICNTVVV---------------------TSP----- 590

  Fly   728 GKQRQKLLASSTSTTTTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQ 792
            .:.|||:.......:...||               :.::     |..|||         ...|..
Mouse   591 DQPRQKVRVRFELKSPVKTI---------------EDFL-----RRFTPS---------RLASGC 626

  Fly   793 PTLSPISSSAESSPNSESESPSPPMKNKSLSNSISPTGRAKAVINSKITSIATFLNAKTQGKRMK 857
            .::..:|:|..|..:..:..|       |||......| .:..:.....|||:...|...|:...
Mouse   627 SSIGNLSTSKSSHKSGSAFLP-------SLSQDSMLLG-LEEKLGQTAPSIASNGYASQAGQEES 683

  Fly   858 LPSSKT------GTIYRTADGRPLYEAESPDELALVNAAYSYDCCLLNRSPNQILVSMPMAGATR 916
            ..|..|      |......:|...||||||||.|||.||.:|:|.|::|..:|:.|.:|..|.. 
Mouse   684 WASECTTDQKCPGEQREQQEGELRYEAESPDEAALVYAARAYNCALVDRLHDQVSVELPHLGRL- 747

  Fly   917 EYEILKVLPFDSSRKCMSIVVRQIGSQEIVLYTKGADSSIMPVLVPCSHNSPEG----ILREQTQ 977
            .:|:|..|.|||.||.||:|:|...:.||.:|||||||.:|.:|:|||.:...|    .:|.:||
Mouse   748 TFELLHTLGFDSIRKRMSVVIRHPLTDEINVYTKGADSVVMDLLLPCSSDDARGRHQKKIRSKTQ 812

  Fly   978 QLLDRYAREGLRILVMAKRTLNSADYTDWWARHQEIEMSLENRERRLRDSFAKLESNLTLLGATG 1042
            ..|:.||.||||.|.:|||.|:..:|..|...|.|.|.|:|:||..|..|..:||:||.||||||
Mouse   813 NYLNLYAVEGLRTLCIAKRVLSKEEYACWLQSHIEAEASVESREELLFQSAVRLETNLHLLGATG 877

  Fly  1043 IEDRLQDGVPETIASLLSAGISVWVLTGDKPETAINIAYSAKLFTQQMELIRLTARSRDAAETAI 1107
            ||||||:|||||||.|..||:.:|||||||.||||||||:.||.....|:|.|.|.|::|....:
Mouse   878 IEDRLQEGVPETIAKLRQAGLQIWVLTGDKQETAINIAYACKLLDHGEEVITLNADSQEACAALL 942

  Fly  1108 NFYLTDMENDKTTSTLGYGQSL---------------RKKQRALVVDGKTLTFILDPKSKLILPF 1157
            :..|:.:::....|||...:|.               .....:||:||::|.:.|:  ..|...|
Mouse   943 DQCLSYVQSRNPRSTLQNSESNLSVGFSFNPVSTSTDASPSPSLVIDGRSLAYALE--KSLEDKF 1005

  Fly  1158 LRLSKRCASVLCCRSTPLQKAYLVKVVKEELNLRTLAIGDGANDVSMIQMADVGVGISGQEGMQA 1222
            |.|:|:|.||||||||||||:.:||:|:.:|...|||||||||||||||:|||||||||||||||
Mouse  1006 LFLAKQCRSVLCCRSTPLQKSMVVKLVRSKLKAMTLAIGDGANDVSMIQVADVGVGISGQEGMQA 1070

  Fly  1223 VMAADFTLPRFRYLERLLLAHGYWCYDRLSRMILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQM 1287
            |||:||.:||||||||||:.||:|||.||:.|:|||||||..||.|:||:|.|||||...|:||.
Mouse  1071 VMASDFAVPRFRYLERLLIVHGHWCYSRLANMVLYFFYKNTMFVGLLFWFQFYCGFSASAMIDQW 1135

  Fly  1288 YLMLYNLIFTSLPPLAIGVYDKRVAEDLLLKNPYLYKNGRLGVAYRPHDFWLILLDALYQSLVIF 1352
            ||:.:||:|:|||.|..||.||.|..|:||:.|.|||:|:....|||..|||.::||.:||||.|
Mouse  1136 YLIFFNLLFSSLPQLVTGVLDKDVPADMLLREPQLYKSGQNMEEYRPRAFWLNMVDAAFQSLVCF 1200

  Fly  1353 FVALCAYAESDVGIWEFGTTITASCLFANLVHCAIEIRSWTVLHVLSIVLSLGSFYLFAIVYDSV 1417
            |:...||.:|||.::.:||.:||..||..|:|..||.::||.|:.|:...|...|:..|::|::.
Mouse  1201 FIPYLAYYDSDVDVFTWGTPVTAIALFTFLLHLGIETKTWTWLNWLACGFSTFLFFSVALIYNTS 1265

  Fly  1418 CMNCFGVRSSYWVIFVCFASAVHWLVIMLSTVVAVLPRLLLTTVRISLCP 1467
            |..|:...:.||.:.......:.:|..:::.:.|:||||....::.||.|
Mouse  1266 CATCYPPSNPYWTMQTLLGDPLFYLTCLIAPIAALLPRLFFKALQGSLFP 1315

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 32/60 (53%)
ATPase-Plipid 250..1473 CDD:273734 561/1320 (43%)
E1-E2_ATPase 302..>394 CDD:278548 50/92 (54%)
Cation_ATPase <880..965 CDD:289987 43/85 (51%)
HAD_like <1177..1240 CDD:304363 49/63 (78%)
PhoLip_ATPase_C 1223..1468 CDD:292829 116/246 (47%)
Atp10aNP_033858.2 PhoLip_ATPase_N <64..112 CDD:292826 32/48 (67%)
ATPase-Plipid 65..1323 CDD:273734 561/1318 (43%)
Cation_ATPase <712..796 CDD:289987 43/85 (51%)
HAD_like 868..>931 CDD:304363 44/63 (70%)
HAD_like <1040..1071 CDD:304363 30/31 (97%)
PhoLip_ATPase_C 1071..1316 CDD:292829 116/246 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 993 1.000 Inparanoid score I302
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D37083at33208
OrthoFinder 1 1.000 FOG0000836
OrthoInspector 1 1.000 T616067
orthoMCL 1 0.900 OOG5_128792
Panther 1 1.100 O PTHR24092
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3512
TreeFam 1 0.960
1211.870

Return to query results.
Submit another query.