DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33298 and atp11c

Sequence 1:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster
Sequence 2:XP_004917005.1 Gene:atp11c XenbaseID:XB-GENE-976439 Length:1149 Species:Xenopus tropicalis

Alignment Length:1274 Identity:381/1275 (30%)
Similarity:597/1275 (47%) Gaps:287/1275 (23%)


  Fly   249 QFVGNKIRTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKEVAMIPVLFVLGVT 313
            :|..|:|.::|||:.:||||||.|||.|:||.||:.|.|:..:.: :......:.:|:.||:.||
 Frog    39 KFCDNRIVSSKYTIWNFIPKNLFEQFRRIANFYFLIIFLIQAIVD-TPTSPVTSGLPLFFVITVT 102

  Fly   314 AVKDLFEDRRRRASDKRINNTTCRVYDGETERYKKVKWQELRVGDIVHLSNNETVPADILLLRTS 378
            |:|..:||..|..:|..:|.:|..|.:|  .:..|.:.::::|||||.:.:|||.|.|:::|.||
 Frog   103 AIKQGYEDWLRHRADHEVNKSTVYVIEG--SKCVKKESEKIKVGDIVEVRDNETFPCDLVMLSTS 165

  Fly   379 DPQGVCYIDTCDLDGETNLK------RREVVRGFEEMQSIFVPSKFVSRVEADAPTTKLYRFHGA 437
            ...|.|.:.|..||||:|.|      ...::..:|::.:      |.:.:|.:.|...||:|||.
 Frog   166 CRDGTCTVTTASLDGESNFKTYHAVPETAILGTYEDLNA------FSATIECEQPQPDLYKFHGR 224

  Fly   438 LIHPTGERV---PISTECLLLRESRLKNTDYIEGIVVYAGHETKSMLNNSGPRYKRSQVEQQMNI 499
            :...|.:.|   .:..|.|||:.:.||||..|.|:.:|.|.|||..||..|...|||.||:.:|.
 Frog   225 IDVNTNQDVKARSLGPENLLLKGATLKNTKKIYGVAIYTGMETKMALNYQGKSQKRSAVEKSINA 289

  Fly   500 DVIWCVIILLILCVVGAIGCR----MWLSSFTHFPVPYLPPN-------KLTANMESMWI----- 548
                .:|:.|.:.|..|..|.    :|.|:         |.|       |.....|:..|     
 Frog   290 ----FLIVYLCILVSKATICTSLKYLWQSN---------PANDEPWYNEKTRKEKEAFKILKMFT 341

  Fly   549 -FWTYIVILQVMIPLSLYVTIELCKILQVFHIHNNVDLFDAETNKQTECRAMNITEELGQIQHIF 612
             |.:::|:...:||:|:|||:|:.|.|..|.|..::::||.|.|:.......::.|||||::::|
 Frog   342 DFLSFMVLFNFIIPVSMYVTVEMQKFLGSFFIAWDMEMFDEEINEGALVNTSDLNEELGQVEYVF 406

  Fly   613 TDKTGTLTENKMIFRRCVVNGSDYNHPPSELEKIYSKPGAPAPPLIPNDNLNSDMAQLTQG-TYL 676
            ||||||||||||.|..|.::|..|.:..:                       .|...||.| .|.
 Frog   407 TDKTGTLTENKMEFIECCIDGHKYANTDA-----------------------MDGLSLTDGLAYF 448

  Fly   677 TPHAQRIQE-FLVVLAICNTVIVGAAPHRDMMNASGIIEVQQIGNSPANLKHGKQRQKLLASSTS 740
            ...:|.::| ||..|.:|:||.:....|.|                                   
 Frog   449 GKASQDLEELFLRALCLCHTVQMKEECHTD----------------------------------- 478

  Fly   741 TTTTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQPTLSPISSSAESS 805
                     ||                                                      
 Frog   479 ---------GP------------------------------------------------------ 480

  Fly   806 PNSESESPSPPMKNKSLSNSISPTGRAKAVINSKITSIATFLNAKTQGKRMKLPSSKTGTIYRTA 870
                               |.|.|...                                      
 Frog   481 -------------------SFSSTDNC-------------------------------------- 488

  Fly   871 DGRPLYEAESPDELALVNAAYSYDCCLLNRSPNQILVSMPMAGATREYEILKVLPFDSSRKCMSI 935
                .|.:.||||:|||..|..|....:. :.|.::...........|::|.||.||..|:.||:
 Frog   489 ----AYISSSPDEIALVTGAKRYGFTYMG-TENNVMSVENQKNEIERYQLLHVLNFDPVRRRMSV 548

  Fly   936 VVR-QIGSQEIVLYTKGADSSIMPVLVPCSHNSPEGILREQTQQL---LDRYAREGLRILVMAKR 996
            :|: :.|  :|.|:.||||||:.|           .:.|:|.|::   :::.|.:|.|.|.:|.:
 Frog   549 LVKAETG--KIFLFCKGADSSMFP-----------RVARDQVQRIKVHVEKNALDGYRTLCVAFK 600

  Fly   997 TLNSADYTDWWARHQEIEMSLENRERRLRDSFAKLESNLTLLGATGIEDRLQDGVPETIASLLSA 1061
            .::...|.:...:.:|.:::|::||.||...:..:|:::.|||||.:|||||:...|||.:|.:|
 Frog   601 EVSQELYENINKQLEEAKLALQDREERLAKVYDDIEADMHLLGATAVEDRLQEQAAETIEALHAA 665

  Fly  1062 GISVWVLTGDKPETAINIAYSAKLFTQQMELIRLTA-------RSRDAAETAINFYLTDMENDKT 1119
            |:.||||||||.|||.:..|:.:||....||:.||.       |..|..:..:..|...:..:..
 Frog   666 GMKVWVLTGDKLETAKSTCYACRLFQSNTELLELTTKDLEEYERKEDRLQELLMEYHRKLVQEAP 730

  Fly  1120 TSTLGYGQSLRKKQ-RALVVDGKTLTFILDPKS-----KLILPFLRLSKRCASVLCCRSTPLQKA 1178
            ....|..:|....| ..|::||.||:.||:...     |.|  ||::.::|::|||||..|||||
 Frog   731 KLKGGANRSWTGNQDHGLIIDGATLSLILNSNCSSSHYKNI--FLQICQKCSAVLCCRMAPLQKA 793

  Fly  1179 YLVKVVKEELNLR----TLAIGDGANDVSMIQMADVGVGISGQEGMQAVMAADFTLPRFRYLERL 1239
            .:||:||   |.:    ||::||||||||||..|.||:||.|:||.||..::|:.:|:|::|.:|
 Frog   794 QIVKMVK---NTKGSPITLSVGDGANDVSMILEAHVGIGIKGKEGRQAARSSDYAVPKFKHLRKL 855

  Fly  1240 LLAHGYWCYDRLSRMILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMYLMLYNLIFTSLPPLAI 1304
            |||||:..|.|::.::.||||||..|:...|.||.:||||.|.:.|..||.:||:.|||:|.||.
 Frog   856 LLAHGHLYYVRIAHLVQYFFYKNLCFILPQFLYQFFCGFSQQPLYDAAYLTMYNICFTSMPILAY 920

  Fly  1305 GVYDKRVAEDLLLKNPYLY----KNGRLGVAYRPHDFWLILLDALYQSLVIFFVALCAYAESDV- 1364
            .:.::|:..::|..||.||    .|..|  .:.|..:|.:|  ..::.||.||.....:....: 
 Frog   921 SLLEQRINIEILSSNPKLYMRISDNAML--QWGPFLYWTLL--GAFEGLVFFFGVYFLFQNPALE 981

  Fly  1365 ------GIWEFGTTITASCLFANLVHCAIEIRSWTVLHVLSIVLSLGSFYLFAIVYDSVCMNCFG 1423
                  |.|.|||.:....:|...:..|::.|.||.::.|:|..||..:.:|::.:..:......
 Frog   982 GNGQVYGNWSFGTMVFTILVFTVTLKLALDTRYWTWMNHLAIWGSLAFYVIFSLFWGGIIWPFLK 1046

  Fly  1424 VRSSYWVIFVCFASAVHWLVIMLSTVVAVLPRLLLTTVR 1462
            .:..|:|......|...||.|:|...|::.|.::|..|:
 Frog  1047 QQRMYFVFSHILTSVSIWLGIILLIFVSLYPEIVLILVK 1085

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 22/50 (44%)
ATPase-Plipid 250..1473 CDD:273734 381/1274 (30%)
E1-E2_ATPase 302..>394 CDD:278548 35/92 (38%)
Cation_ATPase <880..965 CDD:289987 30/86 (35%)
HAD_like <1177..1240 CDD:304363 34/67 (51%)
PhoLip_ATPase_C 1223..1468 CDD:292829 79/252 (31%)
atp11cXP_004917005.1 PhoLip_ATPase_N 21..90 CDD:292826 22/52 (42%)
ATPase-Plipid 40..1087 CDD:273734 381/1274 (30%)
E1-E2_ATPase 97..>182 CDD:278548 35/87 (40%)
Cation_ATPase 465..571 CDD:289987 41/279 (15%)
PI-PLCc_GDPD_SF <548..673 CDD:301322 47/138 (34%)
HAD_like <808..856 CDD:304363 27/48 (56%)
PhoLip_ATPase_C 839..1087 CDD:292829 79/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.