DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33298 and atp8b5a

Sequence 1:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster
Sequence 2:XP_021332106.1 Gene:atp8b5a ZFINID:ZDB-GENE-060531-48 Length:1205 Species:Danio rerio

Alignment Length:1306 Identity:409/1307 (31%)
Similarity:636/1307 (49%) Gaps:246/1307 (19%)


  Fly   249 QFVGNKIRTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKEVAMIPVLFVLGVT 313
            ::..|.|:|:||...||:|.||.|||.|:||.||:|:::|..:|.||:......::|::.||.||
Zfish    32 KYATNCIKTSKYNPFSFLPLNLFEQFQRIANAYFLFLLILQVIPAISSLSWFTTVVPLVLVLSVT 96

  Fly   314 AVKDLFEDRRRRASDKRINNTTCRVYDGETERYKKVKWQELRVGDIVHLSNNETVPADILLLRTS 378
            |.||..:|..|..||:::||....|.  .:.:....||..::||||:.|.||:.|.||:|||.:|
Zfish    97 AAKDAIDDINRHRSDRQVNNRKVNVL--ISGKLTSEKWMNVQVGDIIKLENNQFVTADLLLLSSS 159

  Fly   379 DPQGVCYIDTCDLDGETNLKRREVVRGFEEM-QSIFVPSKFVSRVEADAPTTKLYRFHGALIHPT 442
            :|..:.||:|.:||||||||.::.:....:| .::...:.|...|..:.|..:|.||.|.|...|
Zfish   160 EPLNLVYIETAELDGETNLKVKQSLTVTGDMGHNLEALAAFNGEVCCEPPNNRLDRFTGTLTFDT 224

  Fly   443 GERVPISTECLLLRESRLKNTDYIEGIVVYAGHETKSMLNNSGPRYKRSQVEQQMNIDVIWCVII 507
             ::..:..|.:|||...|:|||:..|:|::||.|||.|.|.....:||:.:::.||:.|::...:
Zfish   225 -QKYSLDNERVLLRGCTLRNTDWCFGLVLFAGPETKLMQNCGKSTFKRTSIDRLMNVLVLFIFAL 288

  Fly   508 LLILCVVGAIGCRMWLSSFTHFPVPYLPPNKLTANMESMWIFWTYIVILQVMIPLSLYVTIELCK 572
            |.::|::.|:|..:| .::|........|::..|...:...||:||:||..::|:||||::|:.:
Zfish   289 LALMCIILAVGHGIW-ENYTGSKFNVFLPHEENAAFSAFLTFWSYIIILNTVVPISLYVSMEVIR 352

  Fly   573 ILQVFHIHNNVDLFDAETNKQTECRAMNITEELGQIQHIFTDKTGTLTENKMIFRRCVVNGSDY- 636
            :...::|:.:.:::...|:...|.|...:.||||||::||:|||||||:|.|.|.:|.:||..| 
Zfish   353 LGNSYYINWDRNMYHTRTDTPAEARTTTLNEELGQIKYIFSDKTGTLTQNIMTFNKCSINGKSYG 417

  Fly   637 ---NHPPSELEKI--------YSKPGAPAPPLIPNDNLNSDMAQLTQGTYLTPHAQRIQEFLVVL 690
               .|...:..:|        :|..|...|..:..|:...:..:|        ....:..|..:|
Zfish   418 DVFQHYSGQTLEITEETTPVDFSFNGLADPKFLFYDHSLVEAVKL--------ELPEVHAFFRLL 474

  Fly   691 AICNTVIVGAAPHRDMMNASGIIEVQQIGNSPANLKHGKQRQKLLASSTSTTTTTTIINGPTTQP 755
            |:|:|.                                                           
Zfish   475 ALCHTC----------------------------------------------------------- 480

  Fly   756 QVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQPTLSPISSSAESSPNSESESPSPPMKNK 820
                        :||.:.                                               
Zfish   481 ------------MAEEKK----------------------------------------------- 486

  Fly   821 SLSNSISPTGRAKAVINSKITSIATFLNAKTQGKRMKLPSSKTGTIYRTADGRPLYEAESPDELA 885
                                                              :|..:|:|:||||.|
Zfish   487 --------------------------------------------------EGHLVYQAQSPDEGA 501

  Fly   886 LVNAAYSYDCCLLNRSPNQILVSMPMAGATREYEILKVLPFDSSRKCMSIVVRQIGSQEIVLYTK 950
            ||.||.::.....:|||..|.:.  ..|..|.||:|.:|.|::.||.||::||. ...::.||.|
Zfish   502 LVTAARNFGFVFRSRSPETITIE--EMGIQRTYELLAILDFNNVRKRMSVIVRN-PEGKLSLYCK 563

  Fly   951 GADSSIMPVLVP-CSHNSPEGILREQTQQLLDRYAREGLRILVMAKRTLNSADYTDWWARHQEIE 1014
            |||:.|...|.| ||.      |.|.|.:.|:.:|.||||.||:|.:.|:...:.:|..||.|..
Zfish   564 GADTIIYERLHPSCSK------LMEVTTEHLNEFAGEGLRTLVLAYKDLDEDYFAEWKQRHHESS 622

  Fly  1015 MSLENRERRLRDSFAKLESNLTLLGATGIEDRLQDGVPETIASLLSAGISVWVLTGDKPETAINI 1079
            :::|:||.:|...:.::|.::.|:|||.|||:|||||..||..|..|.|.:|||||||.|||.||
Zfish   623 VAMEDREEKLDKVYEEIEKDMMLIGATAIEDKLQDGVALTIELLAKAEIKIWVLTGDKQETAENI 687

  Fly  1080 AYSAKLFTQQM-ELIRLTARSRDAAETAINFYLTDM----ENDK---TTSTLGYGQSLRKKQR-- 1134
            .||..|..::| ::..:.|.|.:.....:......|    |.||   ....||....:.:.:.  
Zfish   688 GYSCNLLREEMNDVFIVAAHSPEEVRQELRDARLKMQPSTEQDKFLIPEVILGNTPKVVQDEHVN 752

  Fly  1135 ---ALVVDGKTLTFILDPKSKLILPFLRLSKRCASVLCCRSTPLQKAYLVKVVKEELNLRTLAIG 1196
               .||::|.:|.|.|:  |.:.|.|||.:..|.:|:|||.||||||.:|::||......|||||
Zfish   753 GEYGLVINGHSLAFALE--SSMELEFLRTACMCKTVICCRVTPLQKAQVVELVKRYKKAVTLAIG 815

  Fly  1197 DGANDVSMIQMADVGVGISGQEGMQAVMAADFTLPRFRYLERLLLAHGYWCYDRLSRMILYFFYK 1261
            |||||||||:.|.:|||||||||||||:::||:..:||:|:||||.||.|.|.|:.:.:.|||||
Zfish   816 DGANDVSMIKAAHIGVGISGQEGMQAVLSSDFSFAQFRFLQRLLLVHGRWSYLRMCKFLRYFFYK 880

  Fly  1262 NAAFVFLIFWYQLYCGFSGQVMMDQMYLMLYNLIFTSLPPLAIGVYDKRVAEDLLLKNPYLYKNG 1326
            |..|.|:.|||..:||||.|.:.|:.::.||||::|:||.|.:.::|:.|..:..|:.|.||..|
Zfish   881 NFTFTFVHFWYAFFCGFSAQTVYDEGFITLYNLVYTALPVLGMSLFDQDVNANWSLEFPQLYVPG 945

  Fly  1327 RLGVAYRPHDFWLILLDALYQSLVIFFVALCAYAES---------DVGIWEFGTTITASCLFANL 1382
            :|...:....|.:..|.:.|.|||:|||   .||.:         |...::....||.:||...:
Zfish   946 QLSQYFSKRAFMMCALHSCYSSLVLFFV---PYATTYDTARADGRDGADYQSFALITQTCLTVTV 1007

  Fly  1383 -VHCAIEIRSWTVLHVLSIVLSLGSFYL--FAIVYDSVCMNCFGVRSSYWVIFV-----CFASAV 1439
             |...:::..|||::.|.:..|||.|:.  |.:..|.:    |.:|.:.:. |:     |.....
Zfish  1008 CVQLGLDLSYWTVVNHLFVWGSLGMFFFLTFTMYTDGL----FKLRPASFA-FIGTARNCLNQPN 1067

  Fly  1440 HWLVIMLSTVVAVLPRLLLTTVRISLCPDDSTKV---ILQSKRERSRGEALLVTWSRSTSASSIY 1501
            .||.:.|:.::.|||.:....:...:.|..:.||   :.|.|....|....|...|...|..:..
Zfish  1068 VWLTVALTALLCVLPVVAYRFIYCQIYPTINDKVRYKMRQMKEPAPRPRPRLTRRSTRRSGYAFS 1132

  Fly  1502 RITDYG 1507
            ....||
Zfish  1133 HAQGYG 1138

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 23/50 (46%)
ATPase-Plipid 250..1473 CDD:273734 400/1267 (32%)
E1-E2_ATPase 302..>394 CDD:278548 38/92 (41%)
Cation_ATPase <880..965 CDD:289987 37/86 (43%)
HAD_like <1177..1240 CDD:304363 40/63 (63%)
PhoLip_ATPase_C 1223..1468 CDD:292829 86/262 (33%)
atp8b5aXP_021332106.1 P-type_ATPase_APLT_Dnf-like 36..974 CDD:319770 370/1132 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.