DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33298 and atp8b4

Sequence 1:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster
Sequence 2:XP_002936618.2 Gene:atp8b4 XenbaseID:XB-GENE-5831431 Length:1188 Species:Xenopus tropicalis

Alignment Length:1324 Identity:422/1325 (32%)
Similarity:662/1325 (50%) Gaps:242/1325 (18%)


  Fly   239 KTPKRDHPNGQF--VGNKIRTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWVPEISAFGKEV 301
            |...||: |.:|  ..|.|:|:||.:::|:|.||.|||.||||.||:|:::|..:||||:.....
 Frog    16 KANDRDY-NEKFNYANNAIKTSKYNIVTFLPINLFEQFQRVANAYFLFLLILQLIPEISSLSWFT 79

  Fly   302 AMIPVLFVLGVTAVKDLFEDRRRRASDKRINNTTCRVYDGETERYKKVKWQELRVGDIVHLSNNE 366
            .::|::.||.:|||||..:|..|..:|.::||...:|.  .:.:.:..||..:|.|||:.|.||:
 Frog    80 TIVPLVLVLTITAVKDATDDFFRHKTDNQVNNRQSQVL--LSGKLQNEKWMNVRAGDIIKLENNQ 142

  Fly   367 TVPADILLLRTSDPQGVCYIDTCDLDGETNLKRREVVRGFEEM-QSIFVPSKFVSRVEADAPTTK 430
            .|.||:|||.:|:|.|:||::|.:||||||||.|:.:....:: :||...:.|...|..:.|..|
 Frog   143 FVVADMLLLSSSEPHGLCYVETAELDGETNLKVRQALPVTADLGESITRLADFDGEVACEPPNNK 207

  Fly   431 LYRFHGALIHPTGERVPISTECLLLRESRLKNTDYIEGIVVYAGHETKSMLNNSGPRYKRSQVEQ 495
            |.:|.|.||. ...:..::...:|||...::||::..|:|::||.:||.|.|:...::||:.:::
 Frog   208 LDKFTGTLIW-KDNKYSLTNSKILLRGCVVRNTEWCFGMVIFAGPDTKLMQNSGKTKFKRTSIDR 271

  Fly   496 QMNIDVIWCVIILLILCVVGAIGCRMWLSSF-THFPVPYLPPNKL--TANMESMWIFWTYIVILQ 557
            .||..|:|....|:.:.::.|||..:|.... :.|.: ||..|::  ::.......||:||:||.
 Frog   272 LMNTLVLWIFGFLICMGIILAIGNSIWEHQVGSRFRI-YLYWNEVVNSSVFSGFLTFWSYIIILN 335

  Fly   558 VMIPLSLYVTIELCKILQVFHIHNNVDLFDAETNKQTECRAMNITEELGQIQHIFTDKTGTLTEN 622
            .::|:||||::|:.::...:.|:.:..:|.::.....|.|...:.||||||::||:|||||||:|
 Frog   336 TVVPISLYVSVEVIRLGHSYFINWDRKMFYSKRGTPAETRTTTLNEELGQIEYIFSDKTGTLTQN 400

  Fly   623 KMIFRRCVVNGSDYNHPPSELEKIYSKPGAPAP------PLIPNDNLNSDMAQLTQGTYL-TPHA 680
            .|.|.:|.|:|..|.....||.:........||      ||........|.: ||:...| .|: 
 Frog   401 IMTFNKCSVSGKVYGELRDELGRKVGITEKTAPVDFSFNPLADRKFQFYDHS-LTEAIKLEEPY- 463

  Fly   681 QRIQEFLVVLAICNTVIVGAAPHRDMMNASGIIEVQQIGNSPANLKHGKQRQKLLASSTSTTTTT 745
              :||...:|::|:||:                                                
 Frog   464 --VQEVFRLLSLCHTVM------------------------------------------------ 478

  Fly   746 TIINGPTTQPQVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQPTLSPISSSAESSPNSES 810
                                                                            |
 Frog   479 ----------------------------------------------------------------S 479

  Fly   811 ESPSPPMKNKSLSNSISPTGRAKAVINSKITSIATFLNAKTQGKRMKLPSSKTGTIYRTADGRPL 875
            |.                                                       :|| |..:
 Frog   480 EE-------------------------------------------------------KTA-GELV 488

  Fly   876 YEAESPDELALVNAAYSYDCCLLNRSPNQILVSMPMAGATREYEILKVLPFDSSRKCMSIVVRQI 940
            |:.:||||.|||.||.::.....:|:|..|.|.  ..|....|::|.:|.|::.||.||::||..
 Frog   489 YQVQSPDEGALVTAARNFGFIFKSRTPETITVE--EMGKVVTYQLLAILDFNNIRKRMSVIVRNP 551

  Fly   941 GSQEIVLYTKGADSSIMPVLVPCSHNSPEGILREQTQQLLDRYAREGLRILVMAKRTLNSADYTD 1005
            ..| :.||.||||:.:...|    |.|.|.:: ..|...|:.:|.||||.|.:|.:.| |.||..
 Frog   552 EGQ-VKLYCKGADTILFEKL----HESSEDLM-YITSDHLNEFAGEGLRTLALAYKDL-SEDYLK 609

  Fly  1006 WWAR-HQEIEMSLENRERRLRDSFAKLESNLTLLGATGIEDRLQDGVPETIASLLSAGISVWVLT 1069
            ||.: |.|...:|||||.||..::.::|||:.|||||.|||:||:||.|||:|||.|.|.||:||
 Frog   610 WWLKIHHEASTALENREERLAAAYEEIESNMMLLGATAIEDKLQEGVIETISSLLLANIKVWILT 674

  Fly  1070 GDKPETAINIAYSAKLFTQQME---------LIRLTARSRDAAETAI----NFY----LTDMEND 1117
            |||.|||:||.||..:.|..|.         ::.:....|.|.|...    |.|    .::...|
 Frog   675 GDKQETAMNIGYSCHMLTDDMNEIFVISGHTVMEVREELRKAKECTFGQSRNLYNGHQFSEKMQD 739

  Fly  1118 KTTSTLGYGQSLRKKQRALVVDGKTLTFILDPKSKLILPFLRLSKRCASVLCCRSTPLQKAYLVK 1182
            ....|: |.::: ..:.|:|::|.:|...|:  :.:...||.::..|.:|:|||.||||||.:|:
 Frog   740 TKLDTV-YEETV-TGEYAMVINGHSLAHALE--ADMEKEFLEIACMCKTVICCRVTPLQKAQVVE 800

  Fly  1183 VVKEELNLRTLAIGDGANDVSMIQMADVGVGISGQEGMQAVMAADFTLPRFRYLERLLLAHGYWC 1247
            :||:.....||||||||||:|||:.|.:|||||||||||||:|:|::..:||||:||||.||.|.
 Frog   801 LVKKYKKAVTLAIGDGANDISMIKSAHIGVGISGQEGMQAVLASDYSFAQFRYLQRLLLVHGRWS 865

  Fly  1248 YDRLSRMILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMYLMLYNLIFTSLPPLAIGVYDKRVA 1312
            |.|:.:.:.||||||.||..:.||:..:||||.|.:.||.::.|:|:::||||.||:|::|:.|.
 Frog   866 YFRMCKFLCYFFYKNFAFTLVHFWFGFFCGFSAQTVYDQWFITLFNIVYTSLPVLAMGLFDQDVN 930

  Fly  1313 EDLLLKNPYLYKNGRLGVAYRPHDFWLILLDALYQSLVIFFVALCAY---AESD----VGIWEFG 1370
            :...:....||:.|:|.:.:....|::.:...:|.|..:||:...|:   |..|    .....|.
 Frog   931 DQNCMDYTKLYEPGQLNLLFNKRRFFICIAHGIYTSFALFFIPFGAFFNTAGEDGKHIADYQSFA 995

  Fly  1371 TTITASCLFANLVHCAIEIRSWTVLHVLSIVLSLGSFY--LFAIVYDSVCMNCFGVRSSYWVIFV 1433
            .|:..|.:....|...::...||.::...|..||..::  |||:..|.:    |.:..|::. ||
 Frog   996 VTVATSLVIVVSVQIGLDTSYWTAINHFFIWGSLAVYFSILFAMHGDGI----FDIFPSHFP-FV 1055

  Fly  1434 -----CFASAVHWLVIMLSTVVAVLPRLLLTTVRISLCP--DDSTKVILQSKRERSRGEALLVTW 1491
                 ..:....||||.|:||:.|:|.|....::..|.|  .|..:.:.|:|:.|...|..:...
 Frog  1056 GNARNSLSQKSVWLVIFLTTVICVMPVLTFRFLKADLSPTLSDKVRYLQQAKKRRKPLENRMRRV 1120

  Fly  1492 SRSTSASSIYRITDYGSKNQIITT 1515
            .|::|..|.|..:......::||:
 Frog  1121 HRTSSRRSGYAFSHQEGYGELITS 1144

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 25/52 (48%)
ATPase-Plipid 250..1473 CDD:273734 408/1270 (32%)
E1-E2_ATPase 302..>394 CDD:278548 38/92 (41%)
Cation_ATPase <880..965 CDD:289987 32/85 (38%)
HAD_like <1177..1240 CDD:304363 40/63 (63%)
PhoLip_ATPase_C 1223..1468 CDD:292829 85/261 (33%)
atp8b4XP_002936618.2 PhoLip_ATPase_N 14..79 CDD:292826 29/64 (45%)
ATPase-Plipid 28..1101 CDD:273734 407/1267 (32%)
Cation_ATPase 473..569 CDD:289987 40/267 (15%)
HAD_like <798..841 CDD:304363 29/43 (67%)
PhoLip_ATPase_C 841..1095 CDD:292829 85/259 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.