DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33298 and atp11b

Sequence 1:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster
Sequence 2:XP_004914471.1 Gene:atp11b XenbaseID:XB-GENE-989040 Length:1158 Species:Xenopus tropicalis

Alignment Length:1325 Identity:409/1326 (31%)
Similarity:613/1326 (46%) Gaps:279/1326 (21%)


  Fly   232 PNHT------VPPKTPKRDH---PNGQFVGNKIRTTKYTLLSFIPKNLLEQFHRVANLYFIFIVL 287
            |||:      |..|.|:.||   |  :|..|:|.::|||:|:||||||.|||.|:||.||:.|.|
 Frog    22 PNHSETRTVYVANKYPQHDHYVPP--KFADNRIISSKYTVLNFIPKNLFEQFRRIANFYFLIIFL 84

  Fly   288 LNWV------PEISAFGKEVAMIPVLFVLGVTAVKDLFEDRRRRASDKRINNTTCRVYDGETERY 346
            :..:      |..|.       :|:.||:.|||:|..:||..|..:|..:|...  ||...:...
 Frog    85 VQLMIDTPTSPITSG-------LPLFFVITVTAIKQGYEDWLRHKADNEVNGAP--VYVVRSGHL 140

  Fly   347 KKVKWQELRVGDIVHLSNNETVPADILLLRTSDPQGVCYIDTCDLDGETNLKRREVVRGFEEMQS 411
            .|.:.:.:||||||.::.:||.|||::||.:..|.|.|:|.|..||||||||....|:....:||
 Frog   141 VKTRSKNIRVGDIVRVAKDETFPADLVLLSSDRPDGSCHITTASLDGETNLKTHFAVQETAVLQS 205

  Fly   412 IFVPSKFVSRVEADAPTTKLYRFHGAL-IHPTGERV--PISTECLLLRESRLKNTDYIEGIVVYA 473
            ........:.:|...|...||||.|.| |....|.:  .:..:.||||.:|||||..|.|:.||.
 Frog   206 AANLHTLSAVIECQQPEADLYRFVGRLTIRQHSEDIVRSLGPDNLLLRGARLKNTKEIFGVAVYT 270

  Fly   474 GHETKSMLNNSGPRYKRSQVEQQMNIDVIWCVIILLILCVVGAIGCRMWLSSFTHFPVPYLPPNK 538
            |.|.|..||......|||.||:.||..::..:||||...::..|....|.:. ..:..|:.  |:
 Frog   271 GMEAKMALNYKSKSQKRSAVEKSMNSFLLVYLIILLFEAILSTILKYAWQAE-EKWDEPWY--NQ 332

  Fly   539 LTAN-------MESMWIFWTYIVILQVMIPLSLYVTIELCKILQVFHIHNNVDLFDAETNKQTEC 596
            .|.:       ::.:..|..::|:...:||:|||||:|:.|.|..|.|..::||:..|:|::.:.
 Frog   333 KTEHDRNSSKILKFISDFLAFLVLYNFIIPISLYVTVEMQKFLGSFFIGWDLDLYHEESNQRAQV 397

  Fly   597 RAMNITEELGQIQHIFTDKTGTLTENKMIFRRCVVNGSDYNHPPSEL--EKI-YSKPGAPAPPLI 658
            ...::.|||||::::|||||||||||:|.||.|.|||..|.....:|  |.: ...|.||...|.
 Frog   398 NTSDLNEELGQVEYVFTDKTGTLTENEMQFRECSVNGIKYKEINCKLVPEGVTMDFPDAPTTSLS 462

  Fly   659 PNDNLNSDMAQLTQGTYLTPHAQRIQEFLVVLAICNTVIVGAAPHRDMMNASGIIEVQQIGNSPA 723
            ..:.|                      ||..:::|:||.:.    .|.::..|            
 Frog   463 MEEEL----------------------FLKAVSLCHTVQIS----YDQIDGCG------------ 489

  Fly   724 NLKHGKQRQKLLASSTSTTTTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPSPPPNLLFALPA 788
                                                                    ..|.||   
 Frog   490 --------------------------------------------------------DGLRFA--- 495

  Fly   789 QSHQPTLSPISSSAESSPNSESESPSPPMKNKSLSNSISPTGRAKAVINSKITSIATFLNAKTQG 853
                                           ..:||...                          
 Frog   496 -------------------------------NGMSNQFE-------------------------- 503

  Fly   854 KRMKLPSSKTGTIYRTADGRPLYEAESPDELALVNAAYSYDCCLLNRSPNQI---LVSMPMAGAT 915
                                  |.|.||||.|||.|:.......     |.|   ::.:...|..
 Frog   504 ----------------------YYASSPDEKALVEASRRMGVAF-----NGIHGEIMEIKCLGKL 541

  Fly   916 REYEILKVLPFDSSRKCMSIVVRQIGSQEIVLYTKGADSSIMPVLVPCSHNSPEGILREQTQQLL 980
            ..|::|.||.||::|:.||::| :..|.|.:|:||||:||::     |  |:..|.: ::|:..:
 Frog   542 ERYKLLHVLEFDANRRQMSVIV-ESPSGEKILFTKGAESSVL-----C--NAKLGEI-DRTRIHV 597

  Fly   981 DRYAREGLRILVMAKRTLNSADYTDWWARHQEIEMSLENRERRLRDSFAKLESNLTLLGATGIED 1045
            |.:|.:|||.|.:|.|..:..:|.:...|..|.:.:|:.||.||.|.|..:|.:|.:|||||:||
 Frog   598 DEFASKGLRTLCIAYRKFSPEEYNEIDQRLHEAKTALQQREERLADVFNFIERDLVMLGATGVED 662

  Fly  1046 RLQDGVPETIASLLSAGISVWVLTGDKPETAINIAYSAKLFTQQMELIRLTARSRDAAETAINFY 1110
            :|||.|.|||.:|..|||.||||||||.|||::::.|...|.:.|.::.|..:.           
 Frog   663 KLQDKVHETIEALRVAGIKVWVLTGDKHETAVSVSLSCGHFHKNMNILELVQQK----------- 716

  Fly  1111 LTDMENDKTTSTLGYGQSLRKK---QRALVVDGKTLTFILDPKSKLILPFLRLSKRCASVLCCRS 1172
             ||.|..:..|.|  .:.||:.   |..|||||.:|:..|....||   |:.:.:.|::|||||.
 Frog   717 -TDRECAEQLSQL--ARRLREDHVIQHGLVVDGASLSLALREHEKL---FMEVCRNCSAVLCCRM 775

  Fly  1173 TPLQKAYLVKVVKEELNLR-TLAIGDGANDVSMIQMADVGVGISGQEGMQAVMAADFTLPRFRYL 1236
            .|||||.:|:::|...... |||:|||||||||||.|.||:||.|:||.|||..:|:.:.||::|
 Frog   776 APLQKAKVVRLLKTSPEKPITLAVGDGANDVSMIQEAHVGIGIMGKEGRQAVRNSDYAIARFKFL 840

  Fly  1237 ERLLLAHGYWCYDRLSRMILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMYLMLYNLIFTSLPP 1301
            .:|||.||::.|.|::.::.||||||..|:...|.||.||.||.|.:.|.:||.|||:.|||||.
 Frog   841 SKLLLVHGHYYYIRIATLVQYFFYKNVCFITPQFLYQFYCLFSQQTLYDSVYLTLYNICFTSLPI 905

  Fly  1302 LAIGVYDKRVAEDLLLKNPYLY----KNGRLGVAYRPHDFWLILLDALYQSLVIFFVALCAYAES 1362
            |...::::.|...:|...|.||    ||..||  ::|..:|.:|  ....:.|.||.:.....|.
 Frog   906 LMYSLFEQHVHPHVLQSKPGLYRDISKNALLG--FKPFLYWTLL--GFGHAFVFFFGSYFLMGED 966

  Fly  1363 D--------VGIWEFGTTITASCLFANLVHCAIEIRSWTVLHVLSIVLSLGSFYLFAIVYDSVCM 1419
            .        .|.|.|||.:....:....:..|:|...||.::......|:..:::|::.|..:..
 Frog   967 TSLLGNGQMFGNWTFGTLVFTVMVITVTMKMALETHFWTWINHFVTWGSIAFYFIFSLFYGGIIW 1031

  Fly  1420 NCFGVRSSYWVIFVCFASAVHWLVIMLSTVVAVLPRLLLTTVRISLCPDDSTKVILQSKRERSRG 1484
            .....:..|:|.....:|...|..|::..:..:...::.......|.|..:.|..|   .|...|
 Frog  1032 PFLHTQDMYFVFVQLLSSGSAWFAIIIIIIFCLFLDVMKKVAYRHLYPTCTEKAQL---AETGSG 1093

  Fly  1485 ----EALLVTWSRSTSASSIYRITD 1505
                :::....|...:.||..|:.:
 Frog  1094 INCLDSMCCYTSCEAACSSFRRLLE 1118

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 25/56 (45%)
ATPase-Plipid 250..1473 CDD:273734 393/1261 (31%)
E1-E2_ATPase 302..>394 CDD:278548 36/92 (39%)
Cation_ATPase <880..965 CDD:289987 31/88 (35%)
HAD_like <1177..1240 CDD:304363 34/64 (53%)
PhoLip_ATPase_C 1223..1468 CDD:292829 74/257 (29%)
atp11bXP_004914471.1 PhoLip_ATPase_N 29..97 CDD:292826 30/70 (43%)
ATPase-Plipid 47..1086 CDD:273734 393/1262 (31%)
E1-E2_ATPase 104..>188 CDD:278548 35/86 (41%)
Cation_ATPase 474..582 CDD:289987 42/268 (16%)
HAD_like <780..844 CDD:304363 34/64 (53%)
PhoLip_ATPase_C 827..1080 CDD:292829 74/257 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.