DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33307 and CG7953

DIOPT Version :8

Sequence 1:NP_001285911.1 Gene:CG33307 / 2768914 FlyBaseID:FBgn0053307 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001285913.1 Gene:CG7953 / 34801 FlyBaseID:FBgn0028533 Length:297 Species:Drosophila melanogaster

Alignment Length:129 Identity:30/130 (23%)
Similarity:55/130 (42%) Gaps:26/130 (20%)


  Fly    35 ELERQAKEETVHLLNSLFRSQIAYFSEVKAALNPQTKRFQDISLYITRLSQAIDEQELDRKDELW 99
            |.:...|:.....||.:||.:||..::    .|.|..:...|:..||             .|.|:
  Fly    89 EFDLDYKKGIFETLNHVFRLKIAGLND----FNIQKFKLNVITSKIT-------------FDFLF 136

  Fly   100 QNI--FEEFKDSPLLINRQSETGLTDLQYKTLLTGQKLQNISTKFVSDVADY----FWEMAKIS 157
            :||  ..:..|:..||:...:.||: ::|:.  :|:.|.::....::....|    .|..|||:
  Fly   137 KNIDTTAQKYDTDTLIDALRQLGLS-VEYEG--SGELLFDLVNLRIAGTLKYKLPMLWGSAKIT 197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33307NP_001285911.1 None
CG7953NP_001285913.1 JHBP 44..268 CDD:214779 30/130 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20993
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.