DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33299 and ZNF512B

DIOPT Version :8

Sequence 1:NP_995671.2 Gene:CG33299 / 2768912 FlyBaseID:FBgn0053299 Length:193 Species:Drosophila melanogaster
Sequence 2:XP_024307718.1 Gene:ZNF512B / 57473 HGNCID:29212 Length:1084 Species:Homo sapiens

Alignment Length:118 Identity:42/119 (35%)
Similarity:58/119 (49%) Gaps:21/119 (18%)


  Fly    76 PTTYSE---ISKHVPVHVIEKVPLPIPHPVAVQVPNVIRLQIPEPYAVHVPVQQEIHVPVYKIVP 137
            |.|.|.   :||  |:.|.:  |:.|..||.|..|    :.|.:|.:|..|:.....:||.:.||
Human   193 PVTISRPVGVSK--PIGVSK--PVTIGKPVGVSKP----IGISKPVSVGRPMPVTKAIPVTRPVP 249

  Fly   138 EITEKKIPYTVEKPYPVEVEKPY--PVEVIKQIKIPVPKPYPV--PFTIYKHV 186
             :|:   |.||.:|.||....|.  |:.|.|  .:||.||.||  |.|:.|.|
Human   250 -VTK---PVTVSRPMPVTKAMPVTKPITVTK--SVPVTKPVPVTKPITVTKLV 296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33299NP_995671.2 predic_Ig_block 123..>184 CDD:275319 24/65 (37%)
ZNF512BXP_024307718.1 DNA_pol3_gamma3 <237..462 CDD:331207 25/67 (37%)
C2H2 Zn finger 610..631 CDD:275368
C2H2 Zn finger 646..667 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002690
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.