DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33299 and Vajk4

DIOPT Version :8

Sequence 1:NP_995671.2 Gene:CG33299 / 2768912 FlyBaseID:FBgn0053299 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_611205.1 Gene:Vajk4 / 36950 FlyBaseID:FBgn0050101 Length:328 Species:Drosophila melanogaster

Alignment Length:245 Identity:68/246 (28%)
Similarity:91/246 (37%) Gaps:112/246 (46%)


  Fly    54 GGGGSGSLGSGGG----------GDGHF---HH--------------------HTPTTYSE---- 81
            ||........|.|          ||.|.   ||                    |.|.|..:    
  Fly    19 GGAVEDKKAEGDGKTVEKRGLHLGDYHHYQPHHEHIKTVTIEKKIPVPYTVTKHVPYTVEKKIPY 83

  Fly    82 -----------ISKHVPVHVIE--KVPLPIPHPVAV--QVPNVIRLQIPEPYAVHVPVQQ----- 126
                       :.|.|||||.|  |||:.:|.|..|  ::|..:::.:.:||.|.|||.|     
  Fly    84 EVKVDVPQPYIVEKKVPVHVKEYVKVPVHVPKPYEVIKKIPYEVKVPVDKPYEVKVPVPQPYEVI 148

  Fly   127 -----EIHVPV---YKIVPEITE---------------KKIP----YTVEKPYPVEVEKPYPVEV 164
                 |:.|||   |:::.::..               ||:|    |.|||||.|||.|||.|||
  Fly   149 KKIPYEVKVPVPQPYEVIKKVPHEVKVEVPVPKPYEVIKKVPYEVKYEVEKPYDVEVPKPYDVEV 213

  Fly   165 IK------------QIKIPVPKPY----------------PVPFTIYKHV 186
            .|            ::|:||.|||                |.|:|:.|.|
  Fly   214 EKPYTVVVEKKVPYEVKVPVDKPYKVEVEKPYPVHVKVPVPQPYTVEKKV 263

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33299NP_995671.2 predic_Ig_block 123..>184 CDD:275319 36/121 (30%)
Vajk4NP_611205.1 rne <137..313 CDD:236766 40/128 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR47771
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.