DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33299 and Zfp512b

DIOPT Version :8

Sequence 1:NP_995671.2 Gene:CG33299 / 2768912 FlyBaseID:FBgn0053299 Length:193 Species:Drosophila melanogaster
Sequence 2:XP_008760734.2 Gene:Zfp512b / 311721 RGDID:1305284 Length:916 Species:Rattus norvegicus

Alignment Length:180 Identity:53/181 (29%)
Similarity:67/181 (37%) Gaps:47/181 (26%)


  Fly    44 YGDGYGY---GGSGGGGSGSLGSGG--GGDGHFHHHTP-----------------------TTYS 80
            ||..|.|   .|..|.|||....||  |......|.||                       |:.:
  Rat   121 YGLKYHYQRCQGVRGCGSGKRRPGGASGQRPPGPHPTPALPAQGAISDRLAFPCPFCEAAFTSKT 185

  Fly    81 EISKH-VPVHVIEKVPLPIPHPVAVQVPNVIRLQIPEPYAVHVPVQQEIHVPVYKIVPEITEKKI 144
            ::.|| :..|:...:|.|.|.||:..|      .|..|..|..|:.....|.|.|  |....|.|
  Rat   186 QLEKHRIWNHMDHPLPAPKPGPVSRPV------TINRPVGVSKPIGVSKPVTVGK--PVGVSKPI 242

  Fly   145 ----PYTVEKPYPVEVEKPYPVEVIKQIKIPVPKPYPVPFT----IYKHV 186
                |.||.:|.|  |.||..|....|:..|||...|:|.|    :.||:
  Rat   243 GISKPVTVSRPIP--VTKPVTVSRPMQVSRPVPVTKPIPITKPVPLTKHM 290

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33299NP_995671.2 predic_Ig_block 123..>184 CDD:275319 23/69 (33%)
Zfp512bXP_008760734.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002690
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.