DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and Gabbr1

DIOPT Version :8

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:XP_006255941.1 Gene:Gabbr1 / 81657 RGDID:621537 Length:991 Species:Rattus norvegicus

Alignment Length:557 Identity:100/558 (18%)
Similarity:161/558 (29%) Gaps:209/558 (37%)


  Fly   363 LPPEPEIELEAKKAWTFPIAETSPDIPGENQILQEYQKVKIGKRNRKYRCIGINTDISRKSKIKT 427
            ||.:.|||...:               ||.::        :|.:.||....|..||:...|:...
  Rat    56 LPVDYEIEYVCR---------------GEREV--------VGPKVRKCLANGSWTDMDTPSRCVR 97

  Fly   428 FISKS-----------AGDDLVVYHDGGRLRD--------IGQTTENL-KNQRKNHKHKTEPDDI 472
            ..|||           .|.||... ||.|:..        :|.:.... :.|....|...:.:..
  Rat    98 ICSKSYLTLENGKVFLTGGDLPAL-DGARVEFRCDPDFHLVGSSRSVCSQGQWSTPKPHCQVNRT 161

  Fly   473 PVDIGHSDDRVREIGVNTKKLPKIIIP------------PIAEMHVHKNGKLRDIGTSTDKPFWP 525
            |    ||:.|...||.        :.|            |..||.:......|||          
  Rat   162 P----HSERRAVYIGA--------LFPMSGGWPGGQACQPAVEMALEDVNSRRDI---------- 204

  Fly   526 IDDGTDVIYMHPIKTD----RKKLNKLIVDPPPDNGPYK---MPTKEDRRTYYKGCEYHFPGRTE 583
            :.|....:..|..|.|    .|.|.:|:.     |.|.|   ||          ||..       
  Rat   205 LPDYELKLIHHDSKCDPGQATKYLYELLY-----NDPIKIILMP----------GCSS------- 247

  Fly   584 WRRLFFNKIHGKYKLRRPSHWLYTLVFSVLYILFVIIFSMAWFDFIKDDASRKVPMIKMAQPFIS 648
                                 :.|||.....:..:|:.|.          ....|.:...|.|.:
  Rat   248 ---------------------VSTLVAEAARMWNLIVLSY----------GSSSPALSNRQRFPT 281

  Fly   649 FTPIGPRTNPKAVSFDPRNSTEVMEKYAGIMALLEKYGDYGHNPRFGTCTANEKFGYPSGEPCVF 713
            |.    ||:|.|...:|..           :.|.||:|                           
  Rat   282 FF----RTHPSATLHNPTR-----------VKLFEKWG--------------------------- 304

  Fly   714 LKVNRIIGFKTEPYINSDELVKAKIDE--VEFTALKRLLENTTTEEGHLNRTWITCRSDKDKNVL 776
            .|....|...||.:.::.:.::.::.|  :|.|..:....:......:|.|        :|..::
  Rat   305 WKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKR--------QDARII 361

  Fly   777 IEFHPEPAIRTEYTDIEEKIEYIANEGKKSFFGPNDVNRIVALKIKNLKANERVHINCKMWAQNI 841
            :....|...|..:.::.          |:..||...|..::.....|........|||.:  :.:
  Rat   362 VGLFYETEARKVFCEVY----------KERLFGKKYVWFLIGWYADNWFKTYDPSINCTV--EEM 414

  Fly   842 HHRKEGYGQVSFFVLLATN-------ENRERVEKLLR 871
            ....||:......:|...|       .::|.||||.:
  Rat   415 TEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTK 451

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 21/146 (14%)
Gabbr1XP_006255941.1 Sushi 106..156 CDD:278512 9/51 (18%)
PBP1_GABAb_receptor 170..562 CDD:107361 70/416 (17%)
ANF_receptor 186..542 CDD:279440 67/392 (17%)
7tm_3 602..887 CDD:278433
Ax_dynein_light <915..957 CDD:287215
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.