DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and gabbr2

DIOPT Version :8

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_001137515.1 Gene:gabbr2 / 560267 ZFINID:ZDB-GENE-060503-620 Length:935 Species:Danio rerio

Alignment Length:141 Identity:30/142 (21%)
Similarity:59/142 (42%) Gaps:24/142 (17%)


  Fly    12 KHVTTEPNKNG-----------NPSKDDVNTRGSLTSLSEKNDESKNPSSSASLQQAPKVAPKPK 65
            |.||...|.:.           |..|:|..|..|:||:::.|....:...|.:.:...|:....|
Zfish   738 KFVTMRTNPDAATQNRRLKFTQNQKKEDSKTSTSVTSVNQANTSRLDGLQSDNHRLRMKITELDK 802

  Fly    66 KLSISDAGKDTVTQKVKENEE--PGFSKQFEKESIGVRANRNSSATKKENEKLLVKTVPGKSLIK 128
            :|       :.||.::::..|  |...:...:::..:.:.||.: ..|:.||.|...:..|   .
Zfish   803 EL-------EEVTMQLQDTPEKTPYIKQNHYQDANNILSIRNFT-DGKDGEKSLKNHLEQK---P 856

  Fly   129 ESNDENVEPSR 139
            ::...:.:|||
Zfish   857 QAQWGSADPSR 867

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651
gabbr2NP_001137515.1 PBP1_GABAb_receptor 58..440 CDD:107361
ANF_receptor 76..419 CDD:279440
7tm_3 488..739 CDD:278433 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.