DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and ATP1B1

DIOPT Version :8

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_001668.1 Gene:ATP1B1 / 481 HGNCID:804 Length:303 Species:Homo sapiens

Alignment Length:323 Identity:70/324 (22%)
Similarity:120/324 (37%) Gaps:95/324 (29%)


  Fly   584 WRRLFFNKIHGKYKLRRPSHWLYTLVFSVLY---------------ILFVIIFSMAWFDFIKDDA 633
            |::..:|....::..|....|...|:|.|::               :|.:..|...:.|.:....
Human    12 WKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPG 76

  Fly   634 SRKVPMIKMAQPFISFTPIGPRTNPKAVSFDPRNSTEVMEKY--------------AGIMALLEK 684
            ..::|.|:..:  |||.|    .:||:......|....:|||              ..:.:..::
Human    77 LTQIPQIQKTE--ISFRP----NDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKE 135

  Fly   685 YGDYGHNP------RF-----GTCTA--NEKFGYPSGEPCVFLKVNRIIGFKTEPYINSDELVKA 736
            .||:.|..      ||     |.|:.  :|.:||..|:||:.:|:||::|||.:|..|..     
Human   136 RGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNES----- 195

  Fly   737 KIDEVEFTALKRLLENTTTEEGHLNRTWITCR----SDKDK--NVLIEFHPEPAIRTEYTDIEEK 795
                         ||.....:.:.|...:.|.    .||||  ||            ||..:...
Human   196 -------------LETYPVMKYNPNVLPVQCTGKRDEDKDKVGNV------------EYFGLGNS 235

  Fly   796 ----IEYIANEGKKSFFGPNDVNRIVALKIKNLKANERVHINCKMWAQNIHHRKEGYGQVSFF 854
                ::|....||  ...|..:..::|::..||..:..:.|.||.:.:||     ||.:...|
Human   236 PGFPLQYYPYYGK--LLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENI-----GYSEKDRF 291

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 37/154 (24%)
ATP1B1NP_001668.1 Na_K_ATPase_bet 1..303 CDD:273446 70/324 (22%)
immunoglobulin-like 191..303 28/139 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C8537757
eggNOG 1 0.900 E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S5606
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D422722at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11523
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.