DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and atp1b3

DIOPT Version :8

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_989087.1 Gene:atp1b3 / 394687 XenbaseID:XB-GENE-485127 Length:279 Species:Xenopus tropicalis

Alignment Length:337 Identity:78/338 (23%)
Similarity:131/338 (39%) Gaps:109/338 (32%)


  Fly   564 KEDRRTYYKGCEYHFPGRTEWRRLFFNKIHGKYKLRRPSHWLYTLVFSVLYILFVI-IFSMAWFD 627
            ||:.    ||.|   ...::|::..:|...|::..|..|.|...|:|.:::..|:. :|::..:.
 Frog     3 KEEN----KGSE---QSGSDWKQFIYNPQSGEFMGRTASSWALILLFYLVFYGFLAGLFTLTMWV 60

  Fly   628 FIK--DDASRKVPMI--KMAQPFISFTPIGPRTNPKAVSFDPRNSTEVMEKYAGIM-ALLEKYGD 687
            .::  ||:   ||..  :::.|.:.   |.|::....:.| .||.|:..::|...: ..|..|.|
 Frog    61 MLQTLDDS---VPKYRDRVSSPGLM---ISPKSAGLEIKF-TRNKTQSYQEYIQTLHTFLTPYND 118

  Fly   688 --------------------------YGHNPRFGTCTANE--KFGYPSGEPCVFLKVNRIIGFKT 724
                                      ..:....|.|:..|  .|||..|:|||.:|:|||||.|.
 Frog   119 AIQAKNDLCAPGLYFDQDEKDEKKACQFNRSSLGLCSGIEDNTFGYNEGKPCVIVKMNRIIGLKP 183

  Fly   725 E--PYINSDELVKAKIDEVEFTALKRLLENTTTEEGHLNRTWITCRSDKDKNVLIEFHPEPAIRT 787
            |  |.||                                     |.| |.::|.:::.||     
 Frog   184 EGNPKIN-------------------------------------CTS-KTEDVNLQYFPE----- 205

  Fly   788 EYTDIEEKIE--YIANEGKKSFFGPNDVNRIVALKIKNLKAN---ERVHINCKMWA----QNIHH 843
                 ..||:  |....|||:..  |.|..:||:||.....|   :.:.:.||:..    :|...
 Frog   206 -----NGKIDLMYFPYYGKKTHV--NYVQPLVAVKIIPPPYNSSLDEISLECKIHGSRNLKNEDE 263

  Fly   844 RKEGYGQVSFFV 855
            |.:..|:|:|.|
 Frog   264 RDKFLGRVTFKV 275

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 41/155 (26%)
atp1b3NP_989087.1 Na_K-ATPase 11..273 CDD:306737 71/319 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C8541578
eggNOG 1 0.900 E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D422722at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.