DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and GABA-B-R1

DIOPT Version :8

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_001246033.1 Gene:GABA-B-R1 / 34878 FlyBaseID:FBgn0260446 Length:841 Species:Drosophila melanogaster

Alignment Length:256 Identity:53/257 (21%)
Similarity:85/257 (33%) Gaps:88/257 (34%)


  Fly   604 W-LYTLVFSVLYILFVIIFSMAWFDFIKDDASRKVPMIKMAQPFISFTPIGPRTNPKAVSFD--P 665
            | |||:|..:|.|..||:.|...||          |:.:..:.|       |..:|.:.:.|  .
  Fly   579 WKLYTMVSGLLSIDLVILLSWQIFD----------PLQRYLETF-------PLEDPVSTTDDIKI 626

  Fly   666 RNSTEVMEKYAGIMALLEKYGDYGHNPRFGTCTANEKFGYPSGEPCVFLKVNRIIGFKTEPYINS 730
            |...|..|.....|.|...||..|....||...|.|...         :||.:|   ....|:..
  Fly   627 RPELEHCESQRNSMWLGLVYGFKGLILVFGLFLAYETRS---------IKVKQI---NDSRYVGM 679

  Fly   731 DE-------LVKAKIDEV---------EFTAL---------------KRLLENTTTEEGHLNRTW 764
            ..       |:.|.:..|         .|.||               .:::|             
  Fly   680 SIYNVVVLCLITAPVGMVIASQQDASFAFVALAVIFCCFLSMLLIFVPKVIE------------- 731

  Fly   765 ITCRSDKDKNVLIEFHPEPAIRTEYTDIEEKIEYIANEGKKSFFGPNDVNRIVALKIKNLK 825
             ..|..||| ...:::|:.||..|   .||:.:.:..|.:       ::.|::..|.:.::
  Fly   732 -VIRHPKDK-AESKYNPDSAISKE---DEERYQKLVTENE-------ELQRLITQKEEKIR 780

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 24/155 (15%)
GABA-B-R1NP_001246033.1 PBP1_GABAb_receptor 34..437 CDD:107361
ANF_receptor 52..415 CDD:279440
7tm_3 476..730 CDD:278433 39/180 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1055
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.