DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and GABA-B-R3

DIOPT Version :8

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_001245826.1 Gene:GABA-B-R3 / 33248 FlyBaseID:FBgn0031275 Length:1305 Species:Drosophila melanogaster

Alignment Length:296 Identity:61/297 (21%)
Similarity:99/297 (33%) Gaps:95/297 (32%)


  Fly    24 PSKDDVNTRGSLTSLSE-------------KNDESKNPSSSASL--QQAPKVAPK---------- 63
            |::|.:|.|.:....:|             ....|.|..|:|||  |:..|.|.|          
  Fly  1050 PAQDLINLRLAHQQATEAKTGLINRLRGIFSRTTSSNKGSTASLADQKGLKAAFKSHMGLFTRLI 1114

  Fly    64 PKKLSIS------DAGKDTVTQKVKENEEPGFSKQFEKESIGVRANRNSSATKKENEKLLVKTVP 122
            |...:.|      :..:|::..:...:......|...:.|:..........||..| .|.:.|:.
  Fly  1115 PSSQTASCNAIYNNPNQDSIPSEASSHPNGNHLKPIHRGSLTKSGTHLDHLTKDPN-FLPIPTIS 1178

  Fly   123 GKSLIKESNDENVE---------------PSRRTKS---QPVGKKVYEESSTR---RVREPFDSF 166
            |    .|..|:.:.               ||.|..|   ||...:.....|.|   |:..|..| 
  Fly  1179 G----GEQGDQTLGGKYVKLLETKVNFQLPSNRRPSVVQQPPSLRERVRGSPRFPHRILPPTCS- 1238

  Fly   167 DREKYLSDMIDYDRSSEDVPEKKLSWEPDSTLRRRFVSNNEYHSSLEGEEEEIDLDSVGSSTMRG 231
                 ||.:.:    |||.|       .|||             |:.|..:.|...|:..:|..|
  Fly  1239 -----LSALAE----SEDRP-------GDST-------------SILGSCKSIPRISLQQATSGG 1274

  Fly   232 SYRMPQNAEDERPVILAEIINMGKLKELKEQRESTN 267
            :::..:.|...|       :::|..:| :||:...|
  Fly  1275 TWKSMETAGKSR-------LSLGDSQE-EEQQAPAN 1302

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651
GABA-B-R3NP_001245826.1 PBP1_GABAb_receptor 157..590 CDD:107361
ANF_receptor 174..568 CDD:279440
7tm_3 633..889 CDD:278433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1055
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.