DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and Shbg

DIOPT Version :8

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:XP_006246648.1 Gene:Shbg / 24775 RGDID:3671 Length:445 Species:Rattus norvegicus

Alignment Length:107 Identity:27/108 (25%)
Similarity:42/108 (39%) Gaps:21/108 (19%)


  Fly   689 GHNPR--------FGTCTANEKFG--YPSGEPCVFLKVNRIIGFKTEPYINSDELVKAKIDEVEF 743
            ||..:        .|.|..:.:.|  :|.|....| .:..|....|:|:..|.||....:|    
  Rat   244 GHQAQLSTSARTSLGNCDVDLQPGLFFPPGTHAEF-SLQDIPQPHTDPWTFSLELGFKLVD---- 303

  Fly   744 TALKRLLENTTTEEGHLNRTWITCRSDKDKNVLIEFHPEPAI 785
             ...|||   |...| .|.:|:|... :|:.|::....||.:
  Rat   304 -GAGRLL---TLGTG-TNSSWLTLHL-QDQTVVLSSEAEPKL 339

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 23/86 (27%)
ShbgXP_006246648.1 Laminin_G_1 118..248 CDD:278483 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.