DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and Atp4b

DIOPT Version :8

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_036642.2 Gene:Atp4b / 24217 RGDID:2178 Length:294 Species:Rattus norvegicus

Alignment Length:347 Identity:60/348 (17%)
Similarity:116/348 (33%) Gaps:131/348 (38%)


  Fly   572 KGCEYHFPGRTEWRRLFFNKIHGKYKLRRPSHWLY-TLVFSVLYILFVIIFSMAWF--------- 626
            |.|....   .|:|:..:|...|:...|.|:.|:: :|.::..|::...:|::..:         
  Rat     8 KSCSQRM---AEFRQYCWNPDTGQMLGRTPARWVWISLYYAAFYVVMTGLFALCIYVLMQTIDPY 69

  Fly   627 -----DFIK----------------------DDASRKVPMIKMAQPFIS-FTPIGPRTN------ 657
                 |.:|                      .:.|....:......|:: :||...:.:      
  Rat    70 TPDYQDQLKSPGVTLRPDVYGERGLQISYNISENSSWAGLTHTLHSFLAGYTPASQQDSINCSSE 134

  Fly   658 ----------PKAVSFDPRNSTEVMEKYAGIMALLEKYGDYGHNPRFGTCTANEKFGYPSGEPCV 712
                      |....|..:.:.::::..:|::                    :..||:..|:||.
  Rat   135 KYFFQETFSAPNHTKFSCKFTADMLQNCSGLV--------------------DPSFGFEEGKPCF 179

  Fly   713 FLKVNRIIGFKTEPYINSDELVKAKIDEVEFTALKRLLENTTTEEGHLNRTWITCRSDKDK---- 773
            .:|:|||:.|                          |..|.|..     |...|.:.|..|    
  Rat   180 IIKMNRIVKF--------------------------LPSNNTAP-----RVDCTFQDDPQKPRKD 213

  Fly   774 --NVLIEFHPEPAIRTEYTDIEEKIEYIANEGKKSFFGPNDVNRIVALKIKNLKANERVHINCKM 836
              .:.::::|.....:        :.|....|||:  .|:..|.:||.|..|:..|.:|.|.||:
  Rat   214 IEPLQVQYYPPNGTFS--------LHYFPYYGKKA--QPHYSNPLVAAKFLNVPKNTQVLIVCKI 268

  Fly   837 WAQNI-----HHRKEGYGQVSF 853
            .|.::     |...|  |:|.|
  Rat   269 MADHVTFDNPHDPYE--GKVEF 288

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 36/155 (23%)
Atp4bNP_036642.2 Na_K_ATPase_bet 2..294 CDD:273446 60/348 (17%)
immunoglobulin-like. {ECO:0000250} 194..294 27/113 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C8534263
eggNOG 1 0.900 E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D422722at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11523
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.