DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and Atp1b2

DIOPT Version :8

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:XP_006246642.1 Gene:Atp1b2 / 24214 RGDID:2171 Length:306 Species:Rattus norvegicus

Alignment Length:328 Identity:67/329 (20%)
Similarity:117/329 (36%) Gaps:101/329 (31%)


  Fly   583 EWRRLFFNKIHGKYKLRRPSHWLYTLVF-SVLYILFVIIFSMAWFDFIKDDASRKVPMI--KMAQ 644
            ||:...:|....::..|..:.|.:.|:| .|.|.....:|::..:..:: ..|...|..  ::|.
  Rat    16 EWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMWVMLQ-TVSDHTPKYQDRLAT 79

  Fly   645 PFISFTPIGPRTNPKAVSFD---PRNSTEVMEKYA-GIMALLEKYGD--------------YGHN 691
            |       |....||..:.|   ..:.||..:::. .:...||.|.|              |...
  Rat    80 P-------GLMIRPKTENLDVIVNISDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQ 137

  Fly   692 P-----------------RFGTCTA---NEKFGYPSGEPCVFLKVNRIIGFKTEPYINSDELVKA 736
            |                 :.|.|:.   ...:||.:|:||||:|:||:|.|    |..:::.:. 
  Rat   138 PDNGVLNYPKRACQFNRTQLGNCSGIGDPTHYGYSTGQPCVFIKMNRVINF----YAGANQSMN- 197

  Fly   737 KIDEVEFTALKRLLENTTTEEGHLNRTWITCRSDKDKNVLIEFHPEPAIRTEYTDIEE------- 794
                                        :||...:.::...:..|.|....: .|.|.       
  Rat   198 ----------------------------VTCVGKRPQHYRDKGRPIPKDGKD-EDAENLGHFIMF 233

  Fly   795 ------KIEYIANEGKKSFFGPNDVNRIVALKIKNLKANERVHINCKMWAQNI---HHRKEGYGQ 850
                  .:.|....|||  |..|....:||:|..|:..|..|::.|::.|.||   ..|.:..|:
  Rat   234 PANGNIDLMYFPYYGKK--FHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGR 296

  Fly   851 VSF 853
            |:|
  Rat   297 VAF 299

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 36/160 (23%)
Atp1b2XP_006246642.1 Na_K_ATPase_bet 2..305 CDD:273446 67/329 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C8541746
eggNOG 1 0.900 E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D422722at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11523
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.