DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and nkb-3

DIOPT Version :8

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_510300.1 Gene:nkb-3 / 181494 WormBaseID:WBGene00010117 Length:317 Species:Caenorhabditis elegans

Alignment Length:305 Identity:63/306 (21%)
Similarity:108/306 (35%) Gaps:88/306 (29%)


  Fly   586 RLFFNKIHGKYKLRRPSHWLYTLVFSVLYILFVIIFSMAWFDFIKDDASRKVP------MIKMAQ 644
            :..:||..|....|..:.|....||.:::.:|:..|.:............|||      .|....
 Worm    28 QFLYNKDKGTVLGRTGTSWCQITVFYIIFYIFLSAFFIGCLSIFLRTLDPKVPRFYGKGTIIGVN 92

  Fly   645 PFISFTPIGPRTNPKA--VSFDPRNS------TEVMEKYAGIMALLEKY---------GDYGHNP 692
            |.:.:.| ..:.||.:  :.|:.::|      .:.::.|      |.||         |...:|.
 Worm    93 PGVGYQP-WLKENPDSTLIKFNLQDSKSWEPYVKQLDNY------LSKYKNTNETRDCGASDNND 150

  Fly   693 RFGT------------------CTANEKFGYPSGEPCVFLKVNRIIGFKTEPYINSD--ELVKAK 737
            ...|                  |.|.:::||.||:|||.:.:||:||::...|.:..  |.:|.:
 Worm   151 ALETDTDTFPCRFDLGLFEKANCGAKDQYGYKSGKPCVAVSLNRLIGWRPVNYDDGSVPEEIKGR 215

  Fly   738 IDEVEFTALKRLLENTTTEEGHLNRTWITCRS----DKDKNVLIEFHPEPAIRTEYTDIEEKIEY 798
            ......|                    |.|..    ||:....:::.||..|...|      ..|
 Worm   216 YKPGSIT--------------------INCEGATSFDKEHLGKVKYIPETGIDGRY------YPY 254

  Fly   799 IANEGKKSFFGPNDVNRIVALKIKNLKANERVHINCKMWAQNIHH 843
            :        |.|:....|..:|...:..|:.|.:.|:.:|.||.|
 Worm   255 V--------FVPSYQQPIAMVKFDTIPRNKLVIVECRAYASNIEH 291

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 35/148 (24%)
nkb-3NP_510300.1 Na_K-ATPase 24..300 CDD:278704 63/306 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C8308839
eggNOG 1 0.900 E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D422722at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11523
Phylome 1 0.910 0.664 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.