DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and nkb-2

DIOPT Version :8

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_501958.1 Gene:nkb-2 / 177950 WormBaseID:WBGene00008074 Length:374 Species:Caenorhabditis elegans

Alignment Length:331 Identity:68/332 (20%)
Similarity:118/332 (36%) Gaps:122/332 (37%)


  Fly   601 PSHWLYTLVFSVLYILF----VIIFSMAWFDFIKDDASRKVPMIKMAQPFISFTPIGPRTNPKAV 661
            |..::::.:|  |::|:    ::..::.||:|.:.|  |:.|:......|:...|        .|
 Worm   100 PYGYIFSFIF--LFVLWGLATMLAIALVWFNFSRLD--RQYPIYFGDGSFLGGAP--------KV 152

  Fly   662 SFDP----------RNS------------------TEVMEKYAGIMA---------------LLE 683
            ||||          :|:                  .:|::||:|.:.               ..|
 Worm   153 SFDPNPRQFLEDGTKNAMSWNIYEFSTYVNYLIRYKQVLKKYSGGIGKQKVKKEEMCKNQTMTRE 217

  Fly   684 KYGDYGHNPRFGTCTAN-----EKFGYPSGEPCVFLKVNRIIGF-------KTEPYINSDEL--- 733
            ....:.....||.||.:     ..|||..|:||:.||:|:|:|:       |.:....|.:|   
 Worm   218 NACKFDRLTDFGECTLSLDNLERGFGYSKGQPCIMLKLNKIVGWVPNLSPSKNKTKCPSGDLCCG 282

  Fly   734 --VKAKIDEVEFTALKRLLENTTTEEGHLNRTWITCRSDKDKNVLIEFHPEPAIRTEYTDIEEKI 796
              :|.|                             |.|:.|  |..|:.|:..|.|.|      .
 Worm   283 QGIKFK-----------------------------CTSNAD--VKFEYFPKTGIPTCY------F 310

  Fly   797 EYIANEGKKSFFGPNDVNRIVALKIKNLKANERVHINCKMWAQNIHHRKEG-YGQVSFFVLLATN 860
            .| ||:|  .:..|..:     :|:.|:..|....|.|.....:::....| ..:..|.:|:..|
 Worm   311 PY-ANQG--GYEQPYQM-----VKLTNITVNRETTIECAPEDSSLNTLASGKTNEARFHILMTKN 367

  Fly   861 ENRERV 866
            ...|.|
 Worm   368 RPVETV 373

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 35/156 (22%)
nkb-2NP_501958.1 Na_K-ATPase 102..340 CDD:298651 60/295 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3927
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S5606
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D422722at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11523
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.920

Return to query results.
Submit another query.