DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33310 and Atp1b2

DIOPT Version :9

Sequence 1:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster
Sequence 2:NP_038201.1 Gene:Atp1b2 / 11932 MGIID:88109 Length:290 Species:Mus musculus


Alignment Length:317 Identity:68/317 - (21%)
Similarity:114/317 - (35%) Gaps:95/317 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   583 EWRRLFFNKIHGKYKLRRPSHWLYTLVF-SVLYILFVIIFSMAWFDFIKDDASRKVPMI--KMAQ 644
            ||:...:|....::..|..:.|.:.|:| .|.|.....:||:..:..:: ..|...|..  ::|.
Mouse    16 EWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFSLTMWVMLQ-TVSDHTPKYQDRLAT 79

  Fly   645 PFISFTPIGPRTNPKAVSFDPRNSTEVMEKYAGIMALLEKY------------------GDYGHN 691
            |       |....||..:.|...:....|.:...:..|.|:                  |.|...
Mouse    80 P-------GLMIRPKTENLDVIVNISDTESWGQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQ 137

  Fly   692 P-----------------RFGTCTA---NEKFGYPSGEPCVFLKVNRIIGFKTEPYINSDELVKA 736
            |                 :.|.|:.   ...:||.:|:||||:|:||:|.|    |..:::.:. 
Mouse   138 PDNGVLNYPKRACQFNRTQLGDCSGIGDPTHYGYSTGQPCVFIKMNRVINF----YAGANQSMN- 197

  Fly   737 KIDEVEFTALKRLLENTTTEEGHLNRTWITC--RSDKDKNVLIEFHPEPAIRTEYTDIEEKIEYI 799
                                        :||  :.|:|...|..|...||      :....:.|.
Mouse   198 ----------------------------VTCVGKRDEDAENLGHFVMFPA------NGSIDLMYF 228

  Fly   800 ANEGKKSFFGPNDVNRIVALKIKNLKANERVHINCKMWAQNI---HHRKEGYGQVSF 853
            ...|||  |..|....:||:|..|:..|..|::.|::.|.||   ..|.:..|:|:|
Mouse   229 PYYGKK--FHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAF 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 38/148 (26%)
Atp1b2NP_038201.1 Na_K_ATPase_bet 2..289 CDD:273446 68/317 (21%)
immunoglobulin-like. /evidence=ECO:0000250 193..290 28/128 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850795
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.