DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34332 and CG42581

DIOPT Version :9

Sequence 1:NP_001097033.1 Gene:CG34332 / 2768895 FlyBaseID:FBgn0085361 Length:87 Species:Drosophila melanogaster
Sequence 2:NP_001162800.1 Gene:CG42581 / 8673991 FlyBaseID:FBgn0260871 Length:85 Species:Drosophila melanogaster


Alignment Length:84 Identity:81/84 - (96%)
Similarity:82/84 - (97%) Gaps:0/84 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KSNENAYSTRNNEYLTRKDPEQPSVSNMISSPTYTEEIQRIDEEIQDMERLIAQKEKECEILYLF 68
            |||.||||||||||||||||||||||||||||||||||||||||||||||||.||||||||||||
  Fly     2 KSNANAYSTRNNEYLTRKDPEQPSVSNMISSPTYTEEIQRIDEEIQDMERLIVQKEKECEILYLF 66

  Fly    69 QLMHVIRGVLSQNQHLQDI 87
            ||||||||||||||:||||
  Fly    67 QLMHVIRGVLSQNQYLQDI 85



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447043
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007615
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.