DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34332 and CG42581

DIOPT Version :8

Sequence 1:NP_001097033.1 Gene:CG34332 / 2768895 FlyBaseID:FBgn0085361 Length:87 Species:Drosophila melanogaster
Sequence 2:NP_001162800.1 Gene:CG42581 / 8673991 FlyBaseID:FBgn0260871 Length:85 Species:Drosophila melanogaster

Alignment Length:84 Identity:81/85 (95%)
Similarity:82/85 (96%) Gaps:0/85 (0%)


  Fly     4 KSNENAYSTRNNEYLTRKDPEQPSVSNMISSPTYTEEIQRIDEEIQDMERLIAQKEKECEILYLF 68
            |||.||||||||||||||||||||||||||||||||||||||||||||||||.||||||||||||
  Fly     2 KSNANAYSTRNNEYLTRKDPEQPSVSNMISSPTYTEEIQRIDEEIQDMERLIVQKEKECEILYLF 66

  Fly    69 QLMHVIRGVLSQNQHLQDI 87
            ||||||||||||||:||||
  Fly    67 QLMHVIRGVLSQNQYLQDI 85



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C142286602
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.